RetrogeneDB ID:
retro_ecab_755
Organism:
Horse ( Equus_caballus )
Location:
30:10724054-10724333 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
92.47 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
HIGD1A
Parental gene aliases:
No gene alias available
Parental gene description:
HIG1 hypoxia inducible domain family, member 1A [Source:HGNC Symbol;Acc:29527]

Genomic region (view in browser)





>retro_ecab_755
ATGTCGACCAACACAGATGTATCTCTTTCTTCATGTGATGAAGATCAGGGATCTAAACTT
ATCCAAAAAGCTAAAGAGGCACCCTTTGTCCCCATTGGAATGGCAGGGTTTGCAGTAATT
GTTGCATGTGGATTATATAAATTGAAGAGCAGGGGAAATACTAAAATGTCCATTCACCTG
ATCCACATGCGAGTGGCAGCCCAAGGCTTTGTTGTGGGAGCAATGACTCTTGGTATGGGC
TATCACATGTATCAGGAATTCTGGGAAAAACCCAAACCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.1
SRP021940_embryo 0.12
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.16
SRP021940_testis 0.47

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSTNTDVSLSSYDEDQGSKLIRKAKEAPFVPVGMAGFAAIVAYGLYKLKSRGNTKMSVHLIHMRVAAQGFVVGAMTLGMGYHMYQEFWAKPKP
MSTNTDVSLSS.DEDQGSKLI.KAKEAPFVP.GMAGFA.IVA.GLYKLKSRGNTKMS.HLIHMRVAAQGFVVGAMTLGMGYHMYQEFW.KPKP
Retrocopy
MSTNTDVSLSSCDEDQGSKLIQKAKEAPFVPIGMAGFAVIVACGLYKLKSRGNTKMSIHLIHMRVAAQGFVVGAMTLGMGYHMYQEFWEKPKP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide