RetrogeneDB ID:
retro_ecab_756
Organism:
Horse ( Equus_caballus )
Location:
30:12015810-12016481 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.0 %
Coverage:
83.64 %
Frameshifts:
6
Stop codons:
2


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_ecab_756
CATGACACTAATGAAGACGTACTTGTACACCAGACTGCCATACAGAAGAATAACCCCAGG
GAGTACCTTGGCAGTGTAGGAGATGGAGAGACTGTGGAGTTTGACGTTGTTGAAGAAGAA
CAGGATGCAGAGGCAGCAAACGTTACAAGCCCTGGTGGAGTTCCAGTGCAAGGCAGTAAA
TATGCAGCAGATCAGAACCATTATAGACACTATCCATGTCCCAGGGGTCCTTCACACGAT
TACCAGTGGAATGACCAGAATAGTGAGGGAGGGGAAAGAATGGGGGTCGGAGAGCACTCC
CCAGGGCCAGGCCCAACAGCACCCCCCTACCGCAGGCCACAGCACCCACCTTATTACACG
CAGAGACCCTGTGGGCACCGCCACAGTATTCCAGTCCTCCTGCACAGGAAGAAGGGATGG
AAGGTGCTGACAAACAGGGTGCAGGAGAGCAAGGGAGGCCCGTGAAGCAGAATGTGTATC
AGGGTTTAGACCACAATTACCCAGGGTCCCTCCGTGCTGAAAGACATCCTAGAGAGGATG
GCAATGAAGAAGACAAGGAGAATCAAGGAGAGGAGACGCAAGGTCAGCAGCCACCTCAAT
GTTAGTCCCACCTCATCTTCAACTACTGATGCAGATGCCCAGAAAAACCTAAACCACCAG
ATGGCAAAGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.14
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGE-KNEG-SE
.DT.EDV.VHQTAI.KNNPR.YL.SVGDGETVEFDVVE.E..AEAANVT.PGGVPVQGSKYAAD.NHYR.YP..RGP...YQ.N.QNSE.GE.KN.G.SE
Retrocopy
HDTNEDVLVHQTAIQKNNPREYLGSVGDGETVEFDVVEEEQDAEAANVTSPGGVPVQGSKYAADQNHYRHYPCPRGPSHDYQWNDQNSEGGE/KNGG/SE


Parental protein
SAPEGQAQQR-RPYRRRRFPPYYMRRPYGRR-PQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYR-GYRPRFRRGPP-RQRQPREDGNEEDKENQGDET
S.P.GQAQQ...PYRR...PPYY..RP.G.R.PQYS.PP.Q.E.MEGAD.QGAGEQGRPV.QN.Y..G.RP...R.PP...R.PREDGNEEDKENQG.ET
Retrocopy
STPQGQAQQH/PPYRRPQHPPYYTQRPCGHR/PQYSSPPAQEEGMEGADKQGAGEQGRPVKQNVYQ/GFRPQLPRVPP\AERHPREDGNEEDKENQGEET


Parental protein
QGQQPPQRRYRRNFNYRRRRPENPKPQDGKE
QGQQPPQ......FNY..R.PE.PKP.DGK.
Retrocopy
QGQQPPQC*SHLIFNY*CRCPEKPKPPDGKD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide