RetrogeneDB ID:
retro_ecab_76
Organism:
Horse ( Equus_caballus )
Location:
2:61593146-61594298 (-)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
97.16 %
Coverage:
98.48 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
eca-mir-492-1
Parental gene aliases:
No gene alias available
Parental gene description:
eca-mir-492-1 [Source:miRBase;Acc:MI0012676]

Genomic region (view in browser)





>retro_ecab_76
ATGACTACCTACAGCTATCGCCAGTCCTCGGCCACCTCGTCCTTCGGGGGCCTGGGCAGT
GGCTCCCTGCGCTTCGGGGCCGGAGGCACCATCCGCGCGCCCAGCATCCACGGGGGCTCG
GGCGGCCGCGGCGTGTCGGTGTCCTCTGCCAGCTTCGTGACCTCGTCCTCCTCCGGGAGC
TACGGCGGTGGCTATGCGGGCACCCTGGCCGGGTCCGACGGGCTGCCGGCGGGCAACGAG
AAGGAGACCATGCAGAACCTCAACGACCGCCTGGCCTCCTACCTGGACATGGTGCGCGCC
CTGGAGCAGGCCAACGGCGACCTGGAGGTGAAGATCCGCGACTGGTACCTGAAGCAGGGG
CCCGGGCCCGCCCGCGACTACAGCCACTACTTCAAGACCATCGAGGAGCTGCGGGACAAG
ATTCTTGGGGCCACCATTGAGAACTCCAAGATTGTTCTGCAGATCGACAATGCCCGTCTG
GCTGCAGACGATTTCCGAACCAAGTTCGAGACTGAGCAGGCTCTGCGCTTGAGTGTGGAG
GCCGACATCAATGGCCTGCGCAGGGTGCTAGACGAGCTGACCCTGGCCAGGACTGACCTG
AAGATGCAGATCGAAGGCCTGAAGGAGGAGCTGGCCTACCTGAAGAAGAACCACGAGGAG
GAAATCAGTGTCTTGAGGGGCCAGGTCACTGTGGAGGTGGATTCCGCTCCAGGCATTGAC
CTAGCCAAGATCCTGAGCGACATGAGAAGCCAATATGAGGTCATGGCTGAGAAGAACAGG
AAGGATGCTGAAGCCTGGTTCACCACCAAGACTGAGGAGCTGAACCGGGAGGTCGCTGGC
CACACGGAGCAGCTGCAGATTAACAAGACGGAGATCACCGACCTGCGGCGCACCCTCCAG
GGCCTGGAGATCGAGCTGCAGTCTCAGCTCAGCATGAAAGCCGCCCTGGAAGGCACGCTG
GCGGAAACGGAGGCTCGCTTCGGAGCTCAGCTGGCACAGATCCAGGCGCTGATCAGTAGC
ATCGAAGCCCAGCTGAGTGACGTGCGTGCTGACACCGAGCGGCAGAACCAGGAGTACCAG
CTGCTCCTGGACGTCAAGACTCGGGTGGAGCAGGAGATCGCCACCTACCGAAGCCTGCTG
GAGGCCCAGGAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.07
SRP021940_placental_villous 0.36
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MTSYSYRQSSATSSFGGLGSGSLRFGAGGNFRAPSIHGGSGGRGVSVSSARFVTSSSSGSYGGGYAGTLAGSDGLPAGNEKETMQNLNDRLASYLDKVRA
MT.YSYRQSSATSSFGGLGSGSLRFGAGG..RAPSIHGGSGGRGVSVSSA.FVTSSSSGSYGGGYAGTLAGSDGLPAGNEKETMQNLNDRLASYLD.VRA
Retrocopy
MTTYSYRQSSATSSFGGLGSGSLRFGAGGTIRAPSIHGGSGGRGVSVSSASFVTSSSSGSYGGGYAGTLAGSDGLPAGNEKETMQNLNDRLASYLDMVRA


Parental protein
LEQANGDLEVKIRDWYLKQGPGPARDYSHYFKTIEELRDKILGATIENSKIVLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARTDL
LEQANGDLEVKIRDWYLKQGPGPARDYSHYFKTIEELRDKILGATIENSKIVLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARTDL
Retrocopy
LEQANGDLEVKIRDWYLKQGPGPARDYSHYFKTIEELRDKILGATIENSKIVLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLARTDL


Parental protein
EMQIEGLKEELAYLKKNHEEEISVLRGQVGGQVTVEVDSAPGIDLAKILSDMRSQYEVMAEKNRKDAEAWFTTKTEELNREVAGHTEQLQINKTEITDLR
.MQIEGLKEELAYLKKNHEEEISVLRGQV....TVEVDSAPGIDLAKILSDMRSQYEVMAEKNRKDAEAWFTTKTEELNREVAGHTEQLQINKTEITDLR
Retrocopy
KMQIEGLKEELAYLKKNHEEEISVLRGQV----TVEVDSAPGIDLAKILSDMRSQYEVMAEKNRKDAEAWFTTKTEELNREVAGHTEQLQINKTEITDLR


Parental protein
RTLQGLEIELQSQLSMKAALEGTLAETEARFGAQLAQIQALISSIEAQLSDVRADTERQNQEYQLLLDVKTRLEQEIATYRSLLEAQD
RTLQGLEIELQSQLSMKAALEGTLAETEARFGAQLAQIQALISSIEAQLSDVRADTERQNQEYQLLLDVKTR.EQEIATYRSLLEAQD
Retrocopy
RTLQGLEIELQSQLSMKAALEGTLAETEARFGAQLAQIQALISSIEAQLSDVRADTERQNQEYQLLLDVKTRVEQEIATYRSLLEAQD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide