RetrogeneDB ID:
retro_ecab_761
Organism:
Horse ( Equus_caballus )
Location:
31:17406837-17407159 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.64 %
Coverage:
81.82 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
FABP12
Parental gene aliases:
No gene alias available
Parental gene description:
fatty acid binding protein 12 [Source:HGNC Symbol;Acc:34524]

Genomic region (view in browser)





>retro_ecab_761
GGAATAGGAAGAGCTGGCAGGAAACCAGGCTGTCTCGCAAACCCACTGAACCCAACAGCA
CAAATGGAGATGTGATTGCTGTAAAAACCAAAAGCATCTTTAAAATTAATGAGATCTCCT
TTAAGTGGAGAGGAGAATTTGAGGAAACCATAGCAGGTGGCCACAAAATCAAGAGCACGG
TAACTTTAGGTAATGACTCCTTGATTCAGGTTCAGGACCAGGTTGGCAAGGAGCCCCCGG
TAAAGGGAAAGTCAGTGGATGGAAAATGGGGCAGGGAAGTGCTGTGAACAATGTGACCTG
CACCGGGACATATGAGAGTATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GIGRVSRKLGCLA-KPTVTINTKEDVITIKTKSIFKNNEISFKLGEEFEETTPAGRKIKSLVTLDNDSLVQVKDWEGKETTITRRLVDG-KMVVESAVNN
GIGR..RK.GCLA.KPT....T..DVI..KTKSIFK.NEISFK...EFEET...G.KIKS.VTL.NDSL.QV.D..GKE.......VDG.KM...SAVNN
Retrocopy
GIGRAGRKPGCLA/KPTEPNSTNGDVIAVKTKSIFKINEISFKWRGEFEETIAGGHKIKSTVTLGNDSLIQVQDQVGKEPPVKGKSVDG/KMGQGSAVNN


Parental protein
VTCTQTYERV
VTCT.TYE..
Retrocopy
VTCTGTYESI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide