RetrogeneDB ID:
retro_ecab_765
Organism:
Horse ( Equus_caballus )
Location:
31:18666-19666 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.56 %
Coverage:
99.11 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
LDHA
Parental gene aliases:
No gene alias available
Parental gene description:
L-lactate dehydrogenase A chain [Source:RefSeq peptide;Acc:NP_001138352]

Genomic region (view in browser)





>retro_ecab_765
GCCAAGGTGGCGACCGTCCAGCGTGAGCTGCTGGAGCCCTTCTCGTCGGAGGAGGCCGTG
CGCCGCAGCAAGGTCTCGGTGGTGGGCACCGGCGCGGTGGGCATGGCCTGTGCCGTGAGC
ATCCTGTTGAAGGGCCTGAGTGACGAGCTCGCCCTGGTGGACCTCGACGAGGGCCGGCTG
CGGGGGGAGACGATGGACCTTCAGCACGGCAGCCCCTTCCTGAGGATGCCGCACATCGTG
GCCAGCAAGGACTACGTCGTCACCGCCAACTCCAGCCTCGTGATTGTCACCGCAGGCGCG
CGCCAGGAGAAGGGCGAGTCACGCCTCAATTTAGTCCAGCGAAACGTGAGCATCTTTAAG
TTGGTCATTTCCAACGTTATCCGCTACAGCCCTGGCTGCAAACTGATTGTCGTGTCCAAT
CCGGTGGACATCTTAAGTTACGTAGCCTGGAAGTTGAGCGAATTTCCCCAGAACCGCGTC
ATCGGGAGCGGTTGCAACCTGGATACCGCCCGTTTCCGCTTCTTGATTGGGCAGAGGCTT
GGCGTCCACCCCGAGAGCTGTCACGGCTGGGTCCTGGGGGAGCACGGGGACTCCAGCGTT
CCCGTGTGGAGCGGCGTGAACGTCGCCGGTGTCTCCCTGAGGGGTCTGAACACCCGCTGT
GGGGACCGACCGAGACCCCGAGCAGTGGAGAGACGTCCACCGCGACGTGATCGCCAGCGC
CTACGAGATCATCAAAAGGAAGGGCTACACGTCCTGGGCCATCGGGCTGTCGGTGGCCGA
CCTGTCCGAGAGCATCCTGAGGGATCTGCGGAGAGTGCACCCCGTCTCCACCGTGGTCAA
GGGCCTCTACGGAATCACGGAGGAGGTGTTCCTCAGCGTCCCCTGTGTCCTGGGCGAGCG
CGGCATCACCGACCTCGTGAAGGTGAAGCTGACGCCTGAGGAGGAGGCGCGTCTGAAGAA
GAGCGCGGAGACGCTCTGGGAAGTTCAGGAGGCGCTCGAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.87
SRP021940_cerebellum 0.85
SRP021940_embryo 0.77
SRP021940_placental_villous 0.4
SRP021940_synovial_membrane 0.78
SRP021940_testis 117.72

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SKMATVKDQLIQNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTAHSKLVIITAGA
.K.ATV...L......EE.V...K..VVG.GAVGMACA.SIL.K.L.DELALVD..E..L.GE.MDLQHGS.FLR.P.IV..KDY.VTA.S.LVI.TAGA
Retrocopy
AKVATVQRELLEPFSSEEAVRRSKVSVVGTGAVGMACAVSILLKGLSDELALVDLDEGRLRGETMDLQHGSPFLRMPHIVASKDYVVTANSSLVIVTAGA


Parental protein
RQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSV
RQ..GESRLNLVQRNV.IFK..I.NV..YSP.CKL.VVSNPVDIL.YVAWK.S.FP.NRVIGSGCNLD.ARFR.L.G.RLGVHP.SCHGW.LGEHGDSSV
Retrocopy
RQEKGESRLNLVQRNVSIFKLVISNVIRYSPGCKLIVVSNPVDILSYVAWKLSEFPQNRVIGSGCNLDTARFRFLIGQRLGVHPESCHGWVLGEHGDSSV


Parental protein
PVWSGVNVAGVSLKNLH-PELGTDADKEHWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKEDVFLSVPCILGQ
PVWSGVNVAGVSL..L..P..GTD.D.E.W..VH..V..SAYE.IK.KGYTSWAIGLSVADL.ESI...LRRVHP.ST..KGLYGI.E.VFLSVPC.LG.
Retrocopy
PVWSGVNVAGVSLRGLN\PAVGTDRDPEQWRDVHRDVIASAYEIIKRKGYTSWAIGLSVADLSESILRDLRRVHPVSTVVKGLYGITEEVFLSVPCVLGE


Parental protein
NGISDVVKVTLTPEEEARLKKSADTLWGIQKELQ
.GI.D.VKV.LTPEEEARLKKSA.TLW..Q..L.
Retrocopy
RGITDLVKVKLTPEEEARLKKSAETLWEVQEALE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide