RetrogeneDB ID:
retro_ecab_767
Organism:
Horse ( Equus_caballus )
Location:
31:8524959-8526219 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
94.76 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RBBP4
Parental gene aliases:
No gene alias available
Parental gene description:
retinoblastoma binding protein 4 [Source:HGNC Symbol;Acc:9887]

Genomic region (view in browser)





>retro_ecab_767
GCAGCCTTTGATGACGCAGTGGAAGAACGTGTGATCAACGAAGAGTACAAAATGTGGAAA
AAGAACACCCCTTTTCTTTACGATTTGGTGATGACCCATGCCCTGGAGTGGCCCAGCCTG
ACTGCGCAGTGGCTTCCAGATGTGACCAGGCCAGAAGGGAAAGATTTCAGCATTCATCGA
CTTGTCTTGGGGACACACACGTCGGATGAACAAAACCACCTTTTGATAGCCAGTGTGCAG
CTCCCTAACGATGATGCTCAGTTTGATGCTTCACACTACGACAGTGAGAAAGGAGAATTT
GGAGGTTTTGGCTCTGTTAGTGGAAAAATTGAAATACAAATCAAGATCAACCATGAAGGA
GAAGTAAACAGGGCACGTTATATGCCCCAGAACCCTTGCATCATTGCAACAAAGACTCCG
TCCAGTGAAGTTCTTGTTTTTGACTATATGAAACATCCTTCTAAACCAGACCCTTCTGGA
GAGTGAAATCCAGACTTGCGTCTCCGAGGACATCAGAAGGAAGGCTATGGGCTTTCTTGG
AACCCAAACCTCAGTGGGCACTTACTTAGTGCTTCAGATGACCACACCATCTGCCTATGG
GACATCAGTGCCGTTCCAAAGGAAGGAAAAGTTGTGGATGCGAAGACCATCTTTACAGGG
CATACAGCAGTAGTAGAAGATGTTTCCTGGCATCTGCTCCATGAGTCTCTGTTTGGGTCA
GTTGCTGATGATCAGAAACTTATGATCTGGGATACTCATTCAAACAATACTTCCAAACCA
AGCCACTCAGTTGATGCTCACACAGCTGAAGTGAACTGCCTTTCTTTCAATCCTTATAGT
CAGTTCATTCTTGCCACAGGATCAGCTGACAAGACTGTTGCCTTGTGGGGTCTGAGAAAT
CTGAAATTTAAGTTGCATTCCTTTGAATCACATAAGGATGAAATATTCCAGGTTCAGCGG
TCACCTCACAATGAGACAATTTTGGCTTCCAGGGGTACTGATCGCAGGCTGAATGTCTGG
GATTTAAGTAAAATTGGAGAGGAATAGTCCCCAGAAGATGCAGAAGATGGGCCAGCAGAG
TTGTTGTTTATTCATGGTGGTCACACTGCCAAGATATCTGATTTCTCCTGGAATCCCAAT
GAACCTTGGGTGATTTGTTCTGTATCAGAAGACAATATCACGCAGGTGTGGCAAATGGCA
GAGAATATTTATAATGATGAAGACCCTGAAGGAGGCGTGGATCCAGAAGGACAAGGGTCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 4.12
SRP021940_cerebellum 4.23
SRP021940_embryo 7.59
SRP021940_placental_villous 3.35
SRP021940_synovial_membrane 2.92
SRP021940_testis 5.93

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEF
AAFDDAVEERVINEEYK.WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHL.IASVQLPNDDAQFDASHYDSEKGEF
Retrocopy
AAFDDAVEERVINEEYKMWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLLIASVQLPNDDAQFDASHYDSEKGEF


Parental protein
GGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVL-FDYTKHSLAAYPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLW
GGFGSVSGKIEI.IKINHEGEVNRARYMPQNPCIIATKTPSS.VL.FDY.KH.....PSGE.NPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLW
Retrocopy
GGFGSVSGKIEIQIKINHEGEVNRARYMPQNPCIIATKTPSSEVLVFDYMKHPSKPDPSGE*NPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLW


Parental protein
DISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRN
DISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDT.SNNTSKPSHSVDAHTAEVNCLSFNPYS.FILATGSADKTVALW.LRN
Retrocopy
DISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTHSNNTSKPSHSVDAHTAEVNCLSFNPYSQFILATGSADKTVALWGLRN


Parental protein
LKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMA
LK.KLHSFESHKDEIFQVQ.SPHNETILAS.GTDRRLNVWDLSKIGEE.SPEDAEDGP.ELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNI.QVWQMA
Retrocopy
LKFKLHSFESHKDEIFQVQRSPHNETILASRGTDRRLNVWDLSKIGEE*SPEDAEDGPAELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNITQVWQMA


Parental protein
ENIYNDEDPEGSVDPEGQGS
ENIYNDEDPEG.VDPEGQGS
Retrocopy
ENIYNDEDPEGGVDPEGQGS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide