RetrogeneDB ID:
retro_ecab_769
Organism:
Horse ( Equus_caballus )
Location:
31:15962474-15963079 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
92.12 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
PSMB2
Parental gene aliases:
No gene alias available
Parental gene description:
proteasome (prosome, macropain) subunit, beta type, 2 [Source:HGNC Symbol;Acc:9539]

Genomic region (view in browser)





>retro_ecab_769
ATGGAGTACCTCATCGGCATCCAGGGCCCCGACTATGTCCTTGTTGCCTCCGTCCCGGTG
GCCGCTTGCAATATTGTCCAGATGAAGGACGATCATGACAAGATGTTTAAGATGAGTGAA
AAAATCTTACTCCTATGTGTTGGAGAGGCTGGAGACACTGCACAGTTTGCAGAATATATT
CAGAAAAATTTGCAACTTTACAAGATGCGAAATGGTTATGAATTGTCTCCCACAGCAGCA
GCTAATTTCACACGCCGAAACCTGGCTGACTGTCTCCGGAGTCGGACTCCATATCATATC
AACCTCCTCCTGGCTGGCTACAATGAGCATGAGGCGCTCCAGCTCTCTACTACATGGACT
ACCTGGCCGCCTTGGCCAAGGCCCCTTTCGCAGCCCACGGCTATGGTGCCTTTCTGACTC
TCAGTATCCTGGACCGATACTACACACCAACTCTCTCACGTGAGAGGGCAGTGGAGCTTC
TTAGGAAATGTCTAGAGGAGCTCCAGAAACACTTCATCCTGAATCTGCCAGCCTTCAGTG
TTCGAATCATTGACAAAAATGGCATTCACAAGCTAGACAACATTTCTTTTCCTAAACATG
GCTCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.3
SRP021940_embryo 0.24
SRP021940_placental_villous 0.31
SRP021940_synovial_membrane 0.21
SRP021940_testis 0.47

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHV
MEYLIGIQGPDYVLVAS..VAA.NIVQMKDDHDKMFKMSEKILLLCVGEAGDT.QFAEYIQKN.QLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYH.
Retrocopy
MEYLIGIQGPDYVLVASVPVAACNIVQMKDDHDKMFKMSEKILLLCVGEAGDTAQFAEYIQKNLQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHI


Parental protein
NLLLAGYDEHE-GPALYY-MDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPAFSVRIIDKNGIHELDNISFPK
NLLLAGY.EHE.G....Y.MDYLAALAKAPFAAHGYGAFLTLSILDRYYTPT.SRERAVELLRKCLEELQK.FILNLPAFSVRIIDKNGIH.LDNISFPK
Retrocopy
NLLLAGYNEHE/GAPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTLSRERAVELLRKCLEELQKHFILNLPAFSVRIIDKNGIHKLDNISFPK


Parental protein
HGS
HGS
Retrocopy
HGS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide