RetrogeneDB ID:
retro_ecab_77
Organism:
Horse ( Equus_caballus )
Location:
13:19239885-19240878 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.12 %
Coverage:
80.1 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SEPHS1
Parental gene aliases:
No gene alias available
Parental gene description:
selenophosphate synthetase 1 [Source:RefSeq peptide;Acc:NP_001177348]

Genomic region (view in browser)





>retro_ecab_77
ATGGACTCCTGCGTCATACCCCTGAGGCACGGGGGCCTGTCACTGGTGCAGACCACGGAC
TTCTTTTACCCCTTGGTGGAAGATCCTTACATGATGGGGCGCATAGCTTGCGCCAACGTG
CTGAGTGACCTCTACGCCATGGGCATTACTGAATGTGACAACATGCTGATGTTGCTCAGC
GTCAGCCAGAGTATGACTGAGGAGGAAAGAGAAAAGATAACACCACTGATGATCAGAGGC
TTTCGGGACGCTGCCGAGGAAGGAGGGACTGCAGTGACTGGGGGACAGACTGTGGTAAAC
CCCTGGATTATCGTCGGTGGAGTTGCCACTGTGGTATGTCAGCCAAATGAATTTATAATG
CCTGACAGTGCGGTTGTTGGGGATGTGCTCGTGTTAACCAAACCCTTAGGAACCCAGGTT
GCTGTGAATGCCCACCAATGGCTGGATAACCCTGAAAGATGGAATAAGATAAAGATGGTG
GTCTCCAGGGAAGAGGTAGAGCTGGCCTATCAGGAAGCCATGTTCAATATGGCTACCCTA
AACAGAACTGCTGCTGGATTAATGCACACGTTTAATGCCCATGCAGCCACAGATATCACA
GGCTTTGGCATTCTAGGACATTCCCAGAACCTTGCAAAACAACAAAGAAATGAGGTGTCC
TTTGTCATACATAATCTGCCAATCATTGCCAAGATGGCTGCCATCAGCAAGGCCAGTGGA
CGCTTTGGGCTCCTTCAAGGAACCTCAGCAGAAACTTCCGGGGGGTTACTGATTTGTCTG
CCAAGAGAACAGGCAGCTCGCTTTTGTTCTGAAATCAAATCTTCCAAGTATGGAGAGGGT
CACCAAGCATGGATCGTTGGCATTGTGGAAAAGGGAAACCGGACGGCCCGGATCATTGAC
AAGCCTCGGGTTATTGAGGTCCTACCTCGTGGGGCCACTGCTACTGCTCTTGCTCCTGAC
AGTTCCAATGCCTCTTCTGAGCCTAGCTCTTGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 16.38
SRP021940_cerebellum 31.81
SRP021940_embryo 16.03
SRP021940_placental_villous 18.2
SRP021940_synovial_membrane 15.16
SRP021940_testis 14.54

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECDNMLMLLGVSNKMTDRERDKVMPLIIQGFKDAAEEAGTSVTGGQTVLN
MD.CVIPLRHGGLSLVQTTD..YP.V.DPYMMGRIACANVLSDLYAMG.TECDNMLMLL.VS..MT..ER.K..PL.I.GF.DAAEE.GT.VTGGQTV.N
Retrocopy
MDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMMGRIACANVLSDLYAMGITECDNMLMLLSVSQSMTEEEREKITPLMIRGFRDAAEEGGTAVTGGQTVVN


Parental protein
PWIVLGGVATTVCQPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEAMMNMARLNRTAAGLMHTFNAHAATDIT
PWI..GGVAT.VCQPNEFIMPD.AV.GDVLVLTKPLGTQVAV..HQWLD.PE.WNKIK.VV..E.VELAYQEAM.NMA.LNRTAAGLMHTFNAHAATDIT
Retrocopy
PWIIVGGVATVVCQPNEFIMPDSAVVGDVLVLTKPLGTQVAVNAHQWLDNPERWNKIKMVVSREEVELAYQEAMFNMATLNRTAAGLMHTFNAHAATDIT


Parental protein
GFGILGHAQNLAKQQRNEVSFVIHNLPVLAKMAAVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKGNRTARII
GFGILGH.QNLAKQQRNEVSFVIHNLP..AKMAA.SKA.G..FGL..GT..ETSGGLLICLPREQAARFC.EIKS.KYGEGHQAWI.GIVEKGNRTARII
Retrocopy
GFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAISKASGR-FGLLQGTSAETSGGLLICLPREQAARFCSEIKSSKYGEGHQAWIVGIVEKGNRTARII


Parental protein
DKPRIIEVAPQVAT
DKPR.IEV.P..AT
Retrocopy
DKPRVIEVLPRGAT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide