RetrogeneDB ID:
retro_ecab_770
Organism:
Horse ( Equus_caballus )
Location:
31:19580849-19582035 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.97 %
Coverage:
51.09 %
Frameshifts:
6
Stop codons:
4


Parental gene:
Parental gene symbol:
PNPLA8
Parental gene aliases:
No gene alias available
Parental gene description:
patatin-like phospholipase domain containing 8 [Source:HGNC Symbol;Acc:28900]

Genomic region (view in browser)





>retro_ecab_770
TCACTGAAACCACAGAAAGAGACATCGAGGATAAGCGGGGACTACTGTCTTGATGACCAA
ACTTGGGCGTTAGGTCAAGCACTGAGGACACCTGATTCAAAGCTCTGCATTAACAGGGTT
GAAGAACTTGACTTTTCATCTTCCAGAACTTCCTGAAGGAAAAGGAGTGGCTTCCAAGGA
AAGAATTACTCCATATTTATTATGACTGAGACAAATTAAGGATGGCACTCTTCAGGCTGC
AGTGACAGAAATTTTGGCCTTAATTGGCTATGCAAATCCAGCGAAAGGAAGAGGTATCTG
AATTCTCACAATTGATGACGGAGGAGCGAGGGATGCAGTTGCTCTTCAGATATGGTGAAA
GTCAGTTCAACGCACTCGAAAGCCAGCTGTCAGCTCTTTGATTGCATTTCTGGTGTAAGC
ACAGGTGCCATATTAGCTTTCATGTTGGGATTGTTTCATATGCCCCTGGACAAACATGAG
GCAGTTATTATAAATTAGGATCACATGTGTTTTCACAAAATATTGCTGTTGGAATGGTCA
AAATGAGCTGGAGCCATGCATTTTATGACCGTCAAATGTGGGGAATTTTCTTAAGGATAG
AATGGGATATGCACTCATGATTGAAACAGCAAGAAGTCCATATGTCCAAAGGTAGCAGCA
TCAAGTCCCATGGTATAAAGTGGGGTAATGCCAAAAGTTTGCAGGTTCAGAAACTATGCT
CACCCTCCTGAAGTCAACTCTCACTGTTTGGGAGGCTGTCAGTATAAACTGTGGCAGGCC
ACTAGAGCTCCACCTGCTGCTTCAGGCTACTGTGCAGAGTGTGCTTTTGGGAAACGATCC
CCATCAAGATGGAGGTTTTCTTCTGAATAACCTTTCAGCATTAGCAATGCATGAGTGTAA
GTGTTGGCCAGACGTCCCATTAGAGTGCATAGCATCCCTGGGCATTGGATGTTATGAGTA
TATGAGAAGCACCATGATATACATGAGCTTGAAAACCACACAGCCTAATGTCATCAACAG
TGCTACAGATATAGAAGTCCATGTAATACTCGATAACCTATTACCTCCTGACACTTATTT
CAGATTCAGTCCTGTATTGTGTGAAAACATATCTCTAGATGAAAGTCTAAATGAAAAACT
TTATCAGATGCAGTTGGAACGGTTGAAGTACATAGAAAGCAATGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SLQREKASYSIIARVSIDNRTRALVQALRRTTDPKLCINRVEEL-TFHLLEFPEGKGVAVKEKIIPCLLRLRQIKDETLQAAVREILALIGYVDPVKGRG
SL...K....I......D..T.AL.QALR.T.D.KLCINRVEEL.TFHL.E.PEGKGVA.KE.I.P.LL.LRQIKD.TLQAAV.EILALIGY..P.KGRG
Retrocopy
SLKPQKETSRISGDYCLDDQTWALGQALR-TPDSKLCINRVEEL\TFHLPELPEGKGVASKERITPYLL*LRQIKDGTLQAAVTEILALIGYANPAKGRG


Parental protein
IRILAIDGGGTRGVVALQTLRKLVELTQKPV-HQLFDYICGVSTGAILAFMLGLFHMPLDECEEL-YRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTW-E
I.IL.ID.GG.R..VALQ...K.V..T.KP...QLFD.I.GVSTGAILAFMLGLFHMPLD..E...Y.KLGS.VFSQN..VG.VKMSWSHAFYD.Q.W..
Retrocopy
I*ILTIDDGGARDAVALQIW*KSVQRTRKPA/CQLFDCISGVSTGAILAFMLGLFHMPLDKHEAV/YYKLGSHVFSQNIAVGMVKMSWSHAFYDRQMW/G


Parental protein
NILKDRMGSSLMIETARNP-TCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYKMWQAIRASSAAPGYFEEYA-LGNDLHQDGGLLLNNPS
N.LKDRMG..LMIETAR.P..CPKVAA.S..V..G..PK...FRNY.H.P..NSH.LGGCQYK.WQA.RA..AA.GY..E.A.LGND.HQDGG.LLNN.S
Retrocopy
NFLKDRMGYALMIETARSP/ICPKVAASSPMV*SGVMPKVCRFRNYAHPPEVNSHCLGGCQYKLWQATRAPPAASGYCAECA\LGNDPHQDGGFLLNNLS


Parental protein
ALAMHECKCLWPDVPLECIVSLGTGRYESDVRNAVTYTSLKTKLSNVINSATDTEEVHIMLDGLLPPDTYFRFNPVMCENIPLDESRNEKLDQLQLEGLK
ALAMHECKC.WPDVPLECI.SLG.G.YE...R....Y.SLKT...NVINSATD..EVH..LD.LLPPDTYFRF.PV.CENI.LDES.NEKL.Q.QLE.LK
Retrocopy
ALAMHECKC-WPDVPLECIASLGIGCYEY-MRSTMIYMSLKTTQPNVINSATDI-EVHVILDNLLPPDTYFRFSPVLCENISLDESLNEKLYQMQLERLK


Parental protein
YIERNE
YIE.NE
Retrocopy
YIESNE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide