RetrogeneDB ID:
retro_ecab_771
Organism:
Horse ( Equus_caballus )
Location:
31:21202838-21203236 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
79.1 %
Coverage:
53.2 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS6
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S6 [Source:HGNC Symbol;Acc:10429]

Genomic region (view in browser)





>retro_ecab_771
GGAGAGAAGGATATTCCTGGACTCATTGATGCTACTGTGCCTTGTCACCTGGGGCCCAAA
AGAGCTAGCTGAATCTGCAAACTTTTCAATCTCTCTAAAGAAGATGTTGCCCACCAATAT
GTTGCCAGGAAGCCCCTAAACAAAGAAGGTAAGAAACCTGGGACCAAATCACCTGAGATT
CGGCATCTTGTTACTCACTTGTCTTACAACACAAACGTCGGCGTGTTGCTCTGAAGAAAC
AGTGTACTAAGAAAAATAAGGAAGAAGCTGCATAATATGCTCAACTTTTGGCCAACAGAA
TGAAGGAGGCCAAAGAAAGACTCCAGGAACAGATTACCAAGAGACGGAGGCGGTCCCCTC
TGAGAGCTTCTACCTCTAAGTCCGAGTCTAGTCAAAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.06
SRP021940_cerebellum 0.05
SRP021940_embryo 1.17
SRP021940_placental_villous 0.31
SRP021940_synovial_membrane 0.91
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GEKDIPGLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVT-PRVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAK
GEKDIPGL.D.TVP..LGPKRAS.I.KLFNLSKED...QYV.RKPLNKEGKKP.TK.P.I..LVT...VLQHKRRR.ALKKQ.TKKNKEEAA.YA.LLA.
Retrocopy
GEKDIPGLIDATVPCHLGPKRAS*ICKLFNLSKEDVAHQYVARKPLNKEGKKPGTKSPEIRHLVT/SLVLQHKRRRVALKKQCTKKNKEEAA*YAQLLAN


Parental protein
RMKEAKEKRQEQIAKRRRLSSLRASTSKSESSQK
RMKEAKE..QEQI.KRRR.S.LRASTSKSESSQK
Retrocopy
RMKEAKERLQEQITKRRRRSPLRASTSKSESSQK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide