RetrogeneDB ID:
retro_ecab_778
Organism:
Horse ( Equus_caballus )
Location:
4:25900574-25901373 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.18 %
Coverage:
96.09 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_778
ATGAGGAGATAAAGGAATACATTCCAAGTAAGGAAACAGGATAAAACCACAGAAAAAGAA
TTAAATGAAAGAGAAATAAATTATCTACCTGACAAAGAGTTCAACCAAAGAGTCATAAGG
ATGCTCATTGATCTTGGGAGAAGAACTCAGTGAGAATATCAACAAAGAATTGGAAAATAT
AAAAAAGAACCAATCTGAAATGAAGAATACAATACAAGAAATGAAAACCTTCACTAGAGG
GACTCAATAGCAGAGTAGACACAGAAGAATGAATCAGCAAGCTGGATGAAAGACTAGAGG
AAATCACACAAGCTGAACAGTTAAAAGAAAAAAATTGAAAAAGAGTGAGGGCAGTCTAAG
GGACCTCTGGGACAACATCTATCATACTAATATCTGTGTTATAGTTGTCCCAGGAGGAGA
AGAGAGAGACAAAGGGGCAGAGAATCTATTTGAAGAAATCATAGCTGAAAACTTTCCTAA
CCTAAGGAAGGAAACAGACATCCAAGTACAGGAAGCACAGAGAGCACCAAATAAGAGAAA
CCCAAGGAGGCCCACACCAAGACACATTATAATTGAAAGGTCAAGAATTAAAGATGAGAG
AGAATCCTAAAAGCCACAAGAGAAGGGCAACAAGTTACATACAGAGGAAACCCCATAATG
CTATCTGCTGACTTCTCAGCAGAAACTTTACAGGCTAAAAGGGAGTGGCATGATATATTT
AAAGTGCTGAAAGGAAAAAAACCTACAGCCAAGAATACTCTACCCAGCAAGCTTATCACT
CAGAATGGAAGGAGAGATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MRRQRNMFHARVQDKTPEKELNETQRDNLPDKEFKQKGIRMLID-LGRRMDKHSENVNKELENIKKSQSEMKSTILKMKN-SLEGLNSRVDDTEEWIKKL
MRR.RN.F..R.QDKT.EKELNE.....LPDKEF.Q..IRMLID.LG......SEN.NKELENIKK.QSEMK.TI..MK..SLEGLNSRVD.TEE.I.KL
Retrocopy
MRR*RNTFQVRKQDKTTEKELNEREINYLPDKEFNQRVIRMLID\LGEEL---SENINKELENIKKNQSEMKNTIQEMKT\SLEGLNSRVD-TEE*ISKL


Parental protein
DEKLEEISQVNQ-VKEKTILKNDSKIKELWDNIKHANIRIISVPGGEERHKGEENLFEEIIDENFPNLRKETDIQVQEEQRAPNKSSPKRPTPIHIIIKM
DE.LEEI.Q..Q.V..............LWDNI.H.NI..I.VPGGEER.KG.ENLFEEII.ENFPNLRKETDIQVQE.QRAPNK..P.RPTP.HIII..
Retrocopy
DERLEEITQAEQ/VXXXXXXXSEGSLRDLWDNIYHTNICVIVVPGGEERDKGAENLFEEIIAENFPNLRKETDIQVQEAQRAPNKRNPRRPTPRHIIIER


Parental protein
SKIKDK-ERILKAARERPEVTYKGKPIRLSADFSAETLQATREWHDIFKVLKG-KNLQPRIFYPSRSSFRMEGEI
S.IKD..ERILKA.RE...VTY.G.PI.LSADFSAETLQA.REWHDIFKVLKG.KNLQPRI.YP...S.RMEGEI
Retrocopy
SRIKDE/ERILKATREGQQVTYRGNPIMLSADFSAETLQAKREWHDIFKVLKG\KNLQPRILYPASLSLRMEGEI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide