RetrogeneDB ID:
retro_ecab_779
Organism:
Horse ( Equus_caballus )
Location:
4:28190825-28191133 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
64.49 %
Coverage:
66.25 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS16
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S16 [Source:HGNC Symbol;Acc:10396]

Genomic region (view in browser)





>retro_ecab_779
CTGATGGAGCTGCGCACGCTGCAGTGCAAGCTACTGGAACCTGTTCTGTGCAAGGAGCCA
TTATTGGCGAGGACTCACGTGTCCATGTGAAGGTTAGCGGTCACATGGCCCAAATTTACG
CAATCTGCTAGGCCACCTCCAAAGACCCGGTGGCCTATTACCAGAAATACATGAATGAGG
CTTCCAAGGAGATCAAAGATATCCTTATCCGGTATGACCAGATCCTGCTGGTAGCTGATC
CCTGTCACTGCTAATCCACAAAGTTTGGAGGCCCCCGTGCGGGTGCTCACTCCCAGAAAT
CCTACCGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MIEPRTLQYKLLEPVLLLGKE-RFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEASKKEIKDILIQYDRTLLVADPRRCESKKFGGPGARA
..E.RTLQ.KLLEP...L.KE....G.D.RV.VK..GH.AQIYAI....SK..VAYYQKY..EAS.KEIKDILI.YD..LLVADP..C.S.KFGGP.A.A
Retrocopy
LMELRTLQCKLLEP--VLCKE/AIIGEDSRVHVKVSGHMAQIYAIC*ATSKDPVAYYQKYMNEAS-KEIKDILIRYDQILLVADPCHC*STKFGGPRAGA


Parental protein
RYQKSYR
..QKSYR
Retrocopy
HSQKSYR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide