RetrogeneDB ID:
retro_ecab_782
Organism:
Horse ( Equus_caballus )
Location:
4:31559958-31560876 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
90.52 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPF2
Parental gene aliases:
No gene alias available
Parental gene description:
ribosome production factor 2 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:20870]

Genomic region (view in browser)





>retro_ecab_782
ATGGACGCCTTGGATTGAGCTGTAAAGCCCAAAACGAAAAGGGCCAAGAGATTCTTCGAG
AAGAGAGAACCGAAACTCAGTGAAAATACTAAAAATGCCATGCTGATTAAAGGGGGCAAT
GCAAATTCAACAGTGACACAAGTGCTTAGAGATGTGTATGCACTGAAAAAACCATATGGC
GTTCTGTATAAAAAGAAAAATATTACAAGACCATTTGAGGATCAGACATCATTGGAATTC
TTTTCAAAGAAGTCAGATTGTTCTTTATTCATGTTTGGCCCCCATAATAAGAAGCGACCA
AATAATCTAGTAATAGGCTGTATGTATGACTACCATGTGCTGGATTTGATTGAATCAGGT
ATCCAGAAGTTTGTATCTCTAAAAGATATTAAGAATGGTAAATGTCCTCAGGGAACAAAA
CCTACGTTAATATTTGCTGGTGATGATTTTGATGTAACAGAAGACTACAAAAGGCTAAAA
AGTCTCCTTATTGATTTCTTCAGGGGCCCCACAGTATCAAATATCTGCCTGGCTGGTTTA
GAGTATGTTCTGCACTTCACTGCATTGAATGGGAAGATTTAGTTTCAAAGCTATAAGTTG
CTGTTGAAGAAATCTGGTTGCAGAACACGATGGACTGAATTAGAAGAGATAGGACCCTCA
TTGGATCTTGTTCTGAGGAGGACACATCTGGCATCAGATGACCTCTATAAGCTATCTGTG
AAATCGCCAAAAGCCCTCAAGCCAAATAAGAAGAAAAATCTTTCTCATGGTACTTTTAGT
ACAACTTATGGAAGGATTCATCTGCAGAAGCAAGACCTAAGCAAACTACAAACCAGGAAA
ATGAAGGGGTTGAAGAAGAGACCTGCAGAAAGGATAACAGAAGACCAGGAGAAAAAATCA
AAGAAAATGAGAAAACAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDALDRVVKPKTKRAKRFLEKREPKLSENIKNAMLIKGGNANLTVTQVLRDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRP
MDALD..VKPKTKRAKRF.EKREPKLSEN.KNAMLIKGGNAN.TVTQVLRDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFG.HNKKRP
Retrocopy
MDALD*AVKPKTKRAKRFFEKREPKLSENTKNAMLIKGGNANSTVTQVLRDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGPHNKKRP


Parental protein
NNLVIGRMYDYHVLDMIELGIEKFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKL
NNLVIG.MYDYHVLD.IE.GI.KFVSLKDIKN.KCP.GTKP.LIFAGDDFDVTEDY.RLKSLLIDFFRGPTVSNI.LAGLEYVLHFTALNGKI.F.SYKL
Retrocopy
NNLVIGCMYDYHVLDLIESGIQKFVSLKDIKNGKCPQGTKPTLIFAGDDFDVTEDYKRLKSLLIDFFRGPTVSNICLAGLEYVLHFTALNGKI*FQSYKL


Parental protein
LLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKTPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDQEKKS
LLKKSGCRT...ELEE.GPSLDLVLRRTHLASDDLYKLS.K.PKALKP.KKKN.SH.TF.TTYGRIH.QKQDLSKLQTRKMKGLKKRPAERITEDQEKKS
Retrocopy
LLKKSGCRTRWTELEEIGPSLDLVLRRTHLASDDLYKLSVKSPKALKPNKKKNLSHGTFSTTYGRIHLQKQDLSKLQTRKMKGLKKRPAERITEDQEKKS


Parental protein
KKMKKH
KKM.KH
Retrocopy
KKMRKH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide