RetrogeneDB ID:
retro_ecab_784
Organism:
Horse ( Equus_caballus )
Location:
4:36656546-36657083 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.75 %
Coverage:
99.45 %
Frameshifts:
4
Stop codons:
0


Parental gene:
Parental gene symbol:
CBX3
Parental gene aliases:
No gene alias available
Parental gene description:
chromobox homolog 3 [Source:HGNC Symbol;Acc:1553]

Genomic region (view in browser)





>retro_ecab_784
ATGGCCTTCAATAAAACTATGTTGCAAAAAATGGGAAAGAAACAGAATGGAAAGAGTAAA
AAAATTGAAGAGGCAGAGCCTGAAGAATTTGTATTGGAAAAAGCACAGGACCGATATGTA
GTGGATGGGAAGGCGGAATGTTTCCTGAAGTGGAAGGTAATACAGACTCTGACAATATTG
GGAACCTGAAGAAAGTGTCAATTGTCCAGAGTTAATTGAAATATTTATTAATTCTCAAAG
AACTGGTAAAGAAAAAGGTGGTACAAAAATCTTTATCTGACAGTGAATCTTATGATAGCA
AATCAAAGACAAGAGATGTTGCTGACAAATCAAGAAGCTTTGCCCGAGATCGTGATCCCG
AAGAGAATAATGAGTGCCTCACAGAGCAGTGGAGGATTAATGTTTCTCAGGAAACGCAAA
GATGCCGATGAGGTAGGCTTGGTGCTGGCAAAAGAGGCAAATATGTGGTGTTCCCACATT
GTAACTCCTTTTTATGAAGAGAGACGAACTTGGCATTCCTGCCTGGAAAATGAAGCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWK-GFTDADNT-WEPEENLDCPELIEAFLNSQKAGKEKDGT-KRKSLSDS
MA.NKT.L..............EEAEPEEFV.EK..DR.VV.GK.E.FLKWK.G.TD.DN..WEPEE...CPELIE.F.NSQ..GKEK.GT.K..S.S.S
Retrocopy
MAFNKTMLXXXXXXXXXXXXXXEEAEPEEFVLEKAQDRYVVDGKAECFLKWK/GNTDSDNI/WEPEESVNCPELIEIFINSQRTGKEKGGT\KSLSDSES


Parental protein
ESDDSKSKKKRDTADKPRGFARGLDPE-RIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEA
....SK....RD.ADK.R.FAR..DPE.RI..A..SSG.LMFL.K.KD.DE..LVLAKEANM.C..IV..FYEER.TWHSC.E.EA
Retrocopy
YDSKSKT---RDVADKSRSFARDRDPE\RIMSASQSSGGLMFLRKRKDADEVGLVLAKEANMWCSHIVTPFYEERRTWHSCLENEA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide