RetrogeneDB ID:
retro_ecab_788
Organism:
Horse ( Equus_caballus )
Location:
4:55178416-55179341 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.84 %
Coverage:
56.52 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
ATP5A1
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle [Source:HGNC Symbol;Acc:823]

Genomic region (view in browser)





>retro_ecab_788
CTCCCTCTGCAGGCCAGTCTGGTCTCCAAAAATGCTTTGGGATCTTCTTTGATTGTCACA
AGGAACCTCCTTGCCTCTAACACTTGTCTTCAGAAGGCTGGCACTGCCAAGGTGTCCTCT
GTTCTCAAAGGGTGTATTCTTGGAGCTAATACCTCTGTTGCCCTTGAAGAGACTGGATGT
GTCTCAAGTATTGATGGTGGTATTGCTCGAGTACATGGGCTGAGGAATGTTCAAGCAGAA
GAAAGCATAGAATTTTTTTCAGGCTTAAAGGGTATGTCTCTGAACTTGGAACCTGACAAT
GCTGTTGTTGTTGTGTTTGGAAACAATAAACTAATTAAGGAAGGAAATATTATGAAGAGT
GCAGGAGCCATTGTGGGCATTCTAGTTGGTGAGAAACTGTTGGGTCATGCAGTAGATGCC
CTTGGTAATGTTATTGATGGAAAGGGTCCAGTTGGTGCCAAGACCTGTAGGTGAGTTGGC
CTGAAAGCCCTTGGGATCATTCCTCCAAACTCTGTGCAGGAACCAATGCAGATGGGCATT
AATGCTGTGGATAGCTTGGTGCCAATTTGTCGTGGTCAGCCTGAGCTGATTGTCGGTGAC
CGACAGACTGGCAAAACATCAATGATTGACAAGATCATTAGCCAGAAATGTTTCAATGAT
GAATCTGATGAAAAGAAGAAGCTATACTGTATCTACATTTCTATTGGTCAAAAGAGATCC
ACTGTTGCCCAATTGGTGAAGAGACTTACAGATACCATGAAGTACACCATTGTGGTTTTA
GCTACTGCTTCTGATGCTGGCCCACATCAGTACCTGACTCCTTATTCTGCCTTTCTATGG
GAGAAAATTTAGAGATAATGGCAAACATGCTTTGATCATCTATGACGAGTTATCCAGATA
GACTATTGCTTATTGTCAGATGTCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LPRRAGLVSRNALGSSFIAARNLHASNTRLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDN
LP..A.LVS.NALGSS.I..RNL.ASNT.LQK.GTA..SS.L...ILGA.TSV.LEETG.V.SI..GIARVHGLRNVQAEE..EF.SGLKGMSLNLEPDN
Retrocopy
LPLQASLVSKNALGSSLIVTRNLLASNTCLQKAGTAKVSSVLKGCILGANTSVALEETGCVSSIDGGIARVHGLRNVQAEESIEFFSGLKGMSLNLEPDN


Parental protein
VGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGD
..VVVFGN.KLIKEG.I.K..GAIV...VGE.LLG..VDALGN.IDGKGP.G.KT.R.VGLKA.GIIP..SV.EPMQ.GI.AVDSLVPI.RGQ.ELI.GD
Retrocopy
AVVVVFGNNKLIKEGNIMKSAGAIVGILVGEKLLGHAVDALGNVIDGKGPVGAKTCR*VGLKALGIIPPNSVQEPMQMGINAVDSLVPICRGQPELIVGD


Parental protein
RQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSG-CSMGE-YFRDNGKHALIIY
RQTGKTS..ID.II.QK.FND..DEKKKLYCIY..IGQKRSTVAQLVKRLT..D.MKYTIVV.ATASDA.P.QYL.PYS...SMGE..FRDNGKHALIIY
Retrocopy
RQTGKTSM-IDKIISQKCFNDESDEKKKLYCIYISIGQKRSTVAQLVKRLT--DTMKYTIVVLATASDAGPHQYLTPYSA/LSMGE/KFRDNGKHALIIY


Parental protein
DDLSKQAVAYRQMS
D.LS....AY.QMS
Retrocopy
DELSR*TIAYCQMS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide