RetrogeneDB ID:
retro_ecab_789
Organism:
Horse ( Equus_caballus )
Location:
4:57032424-57032798 (+)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
88.1 %
Coverage:
76.69 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
SKP1
Parental gene aliases:
No gene alias available
Parental gene description:
S-phase kinase-associated protein 1 [Source:HGNC Symbol;Acc:10899]

Genomic region (view in browser)





>retro_ecab_789
ATGCCTTCAATTAAGTTGCAGAGTTCTGATGGAGAGATATTTGAGGTTGATGTGGAAATT
GCCAAGCAATCTATGACTATCAAGACCATGTTGGAAGATTTGGGAATGAATGATGAAGGA
GATGATGATCCAGTTCCTCTACCAAATGTTAATGCAGAATATTACAAAAGGTCATTCATT
GGTGCACCCAACACAAGGATGACCCTCTTTTTCCTGAGGATGATGAGAACAAGGAAAAGC
AGACAGACGATACCCCAGTTTGGGACCAAGAATCCCTGACAGTTGAACAAGGAACACTTT
TTGAACTTATTCTGGCTGCTAACTACTCAGACATCAAAGGTTTGCTTGATGTTACATGCA
AGACTGTTGCAAAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAA-ILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGT
MPSIKLQSSDGEIFEVDVEIAKQS.TIKTMLEDLGM.DEGDDDPVPLPNVNA..IL.KVI.WCT.HKDDP..PEDDENKEK.TDD.PVWDQE.L.V.QGT
Retrocopy
MPSIKLQSSDGEIFEVDVEIAKQSMTIKTMLEDLGMNDEGDDDPVPLPNVNAE/ILQKVIHWCTQHKDDPLFPEDDENKEKQTDDTPVWDQESLTVEQGT


Parental protein
LFELILAANYLDIKGLLDVTCKTVAN
LFELILAANY.DIKGLLDVTCKTVAN
Retrocopy
LFELILAANYSDIKGLLDVTCKTVAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide