RetrogeneDB ID:
retro_ecab_79
Organism:
Horse ( Equus_caballus )
Location:
X:85217250-85217682 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.9 %
Coverage:
89.1 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
NCBP2
Parental gene aliases:
No gene alias available
Parental gene description:
nuclear cap binding protein subunit 2, 20kDa [Source:HGNC Symbol;Acc:7659]

Genomic region (view in browser)





>retro_ecab_79
GAGCTGAGCGAGCATGGGGACCAGCAGTTTGGTGGCGGCAACGAAGAGCATGAAAGATTA
CTGAAGGAAAGCTCGACACTGTATGTGGGAAATCTATCTTTTTATACAACTGAAGAGCAT
GTACTTGAACTCTTCAGTAGATGCGGTGATGTCAAGAATGTATTTATGGGCCTGGGTAAA
GTCAAGAAAGCGGCATGTAATTTCTGTTTTGTAGAATACCATAAGAGAGCTGATGCCGAA
AATGCCTTGTGGTTCCTAAATGGGACCCGCCTAGATGACCGTATCATCCGCGTAGATTGG
GATATAGGCTTTAGAGAGCGCAGACGGTATGGCCGGTATGGCCGTGGCCGATTTCGAGGC
CAGGTAAGAGAGGGGCTTCGTTTTGACTTTGATGCTGGTAGAGGAGGCTTTGGAAAGCAG
ACTCAGGCCCGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 7.36

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW
ELS...DQ.F.G.NEE.E.LLK.S.TLYVGNLSFYTTEE...ELFS..GD.K...MGL.K.KK.AC.FCFVEY..RADAENA....NGTRLDDRIIR.DW
Retrocopy
ELSEHGDQQFGGGNEEHERLLKESSTLYVGNLSFYTTEEHVLELFSRCGDVKNVFMGLGKVKKAACNFCFVEYHKRADAENALWFLNGTRLDDRIIRVDW


Parental protein
DAGFKEGRQYGR---GRSGGQVRDEYRQDYDAGRGGYGKLAQ
D.GF.E.R.YGR...GR..GQVR...R.D.DAGRGG.GK..Q
Retrocopy
DIGFRERRRYGRYGRGRFRGQVREGLRFDFDAGRGGFGKQTQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide