RetrogeneDB ID:
retro_ecab_792
Organism:
Horse ( Equus_caballus )
Location:
4:78026625-78026973 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.93 %
Coverage:
76.0 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
C6orf52
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 6 open reading frame 52 [Source:HGNC Symbol;Acc:20881]

Genomic region (view in browser)





>retro_ecab_792
GTGAAGCCAGAGTTCCAGCCCCACCAAGGTTACTCCTTTGGAAACTAGAATGAGCAACAG
CAGAGCTGTTATTCTCTTTCTGGCTACAGCTGTGGCTGTGCAGTGGGTGGAAATGGACAC
GACCTTCTTTTTGCACATGAGACATTTTGACACTGACGTGAAATTTTGGTTACACTTGAG
GAAACCACAGTTCTGGCTGAAACCCGAGATAAAGACCCACTAGAAGATCCAAGTCTTCAA
TTGAATATTGAGGAATTAAACAGAGAGTTTATGGTGAAAAGTGAAGAACTCTATGACTCT
CTCATGAATTGCCACTGGCAGTGGCAGTTCACTCTAAAATCCCAGATG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VKPEFQPSQGYPFGHWSEHQHSCCSLPDYSSGCAVVGSGHSCLSVCATSGHPAETLVTQEETTSLAENRDEDPIADPNLHLNIEE--KEFMMKSEELYDS
VKPEFQP.QGY.FG...E.Q.SC.SL..YS.GCAV.G.GH..L....T..H..E.LVT.EETT.LAE.RD.DP..DP.L.LNIEE...EFM.KSEELYDS
Retrocopy
VKPEFQPHQGYSFGN*NEQQQSCYSLSGYSCGCAVGGNGHDLLFAHETF*H*REILVTLEETTVLAETRDKDPLEDPSLQLNIEELNREFMVKSEELYDS


Parental protein
LMNCHWQPSDTVHSKI
LMNCHWQ...T..S..
Retrocopy
LMNCHWQWQFTLKSQM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide