RetrogeneDB ID:
retro_ecab_793
Organism:
Horse ( Equus_caballus )
Location:
4:82342520-82342846 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
68.14 %
Coverage:
71.9 %
Frameshifts:
3
Stop codons:
1


Parental gene:
Parental gene symbol:
ATP5G2
Parental gene aliases:
No gene alias available
Parental gene description:
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9) [Source:HGNC Symbol;Acc:842]

Genomic region (view in browser)





>retro_ecab_793
AGCAGCTCTCTTGCCACAGTTCCCCCACTCCCTGAAAACGTATGCCCGCACCAAGTTCAT
CTCCATCCTCTCCCTGGTCAGAATCACCTCTCAGCTGCTGAGCTGACCACTCTCTGCAGT
GGTACTGAAACAACCGACACTGACAGATGAGTGCCTCAGCAGCTTGGCAGCCCCATGTCC
TCTGACCTCATCATCCCTAGTAGCAGCTTCCAAATCAGCACCATTTTAAGGGACACTGAC
ACAGCAGCAAAGTTCATTGAGGTTGGGGCTGCCACAGTGGAGTGGCTGGCTCTGGGGCTG
GGGTTGAGGCTGTGTATGGGACAATG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.2
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SSSPATAP-HPLKMYACAKFVSTPSMVRSTSQLLSRSLSAVVLKRPETLTDETLSSLAAPRPLTS-LIPSRGLQTSAISRDIDTAAKFIGAGAATV-GVA
SSS.AT.P.H.LK.YA..KF.S..S.VR.TSQLLS..LSAVVLK.P.TLTDE.LSSLAAP.PLTS..IPS...Q.S.I.RD.DTAAKFI..GAATV.GVA
Retrocopy
SSSLATVP\HSLKTYARTKFISILSLVRITSQLLS*PLSAVVLKQP-TLTDECLSSLAAPCPLTS/IIPSSSFQISTILRDTDTAAKFIEVGAATV/GVA


Parental protein
GSGAGIGTVFGSL
GSGAG...V.G..
Retrocopy
GSGAGVEAVYGTM


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide