RetrogeneDB ID:
retro_ecab_801
Organism:
Horse ( Equus_caballus )
Location:
4:8471708-8472497 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.94 %
Coverage:
53.12 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
GLRB
Parental gene aliases:
No gene alias available
Parental gene description:
glycine receptor, beta [Source:HGNC Symbol;Acc:4329]

Genomic region (view in browser)





>retro_ecab_801
TTGATAGCCAACCTTTTTATTAACAGTTTTGGATCCATTCAAGAGACAACAATGGACTGT
AGAGTTAACATCTTCCTGAGACAAAAATGGAACGATCCCAGGCTGAAGCTCCCTGGAGAT
TTTCGGGGCTTAGATGCACTGACAGTGGATCCCACAACATACAAGTGTCCGTGGAAACTT
AATTAGTTTTTTCCAAATGAAAAAAGTGCCAATTTTTATGATGTAACACAGGAAAACATC
CTCTTTATTTTGGGGGATGGAGATGTCCTCGTCAGCGTGAGGTTATCTATTGTCTTTCAC
GCCCTTTGAACTTGACTTTGTTTCCCGTGCACACACAACATTGTAAGACACAATTTAAGA
GCTTTGTTTACACAACTGATGATTTACGATTTGTCTGGCAGTCAGGGGATCCTCTCAGTT
AGAAAAAATTGTGCTGCCTCAATTTGATATTAAAAAGGAGGATGTTGAATATGGTGTAAC
TGTACAAAATACTATGAAGGTACTGGCTACTACACACATGTAGAAGTCATCCTCACCCTA
AGGAGACAGATAGGGTTTTCCACGATGGGTGTCTATACCCCAACCCTGCTGATTGTGGTT
CTCTCTTGGCTTTCCTTCTGGATCAATCCAGATACCAGTGCTGCCGGAATGCCCCTGGGT
ATCTTCTCAGTACTCAGCTTGGCCTCTGAGTGCACAACCCTTGCTGCTGAACTCCCCAAA
GTATCGTACACTAAGGCTCTTGATGAATGACTCGTTGCTTGTCTTCTCTTTGGGTTTGCC
TCACTAGTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSIT-
...N.FINSFGSIQETTMD.RVNIFLRQKWNDPRLKLP.DFRG.DALTVDPT.YKC.WK...FF.NEKSANF.DVTQENIL.FI..DGDVLVS.RLSI..
Retrocopy
LIANLFINSFGSIQETTMDCRVNIFLRQKWNDPRLKLPGDFRGLDALTVDPTTYKCPWKLN*FFPNEKSANFYDVTQENIL-FILGDGDVLVSVRLSIV/


Parental protein
LSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIE-YGNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLL
LS.PL.LTLFP..TQ.CK.Q..SF.YTTDDLRF.WQSGDP....K........K........NCTKYY.GTGYYT.VEVI.TLRRQ.GF..MGVY.PTLL
Retrocopy
LSRPLNLTLFPVHTQHCKTQFKSFVYTTDDLRFVWQSGDPLS*KKLCCLNLILKRRMLN\WCNCTKYYEGTGYYTHVEVILTLRRQIGFSTMGVYTPTLL


Parental protein
IVVLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLV
IVVLSWLSFWINPD.SAA..PLGIFSVLSLASECTTLAAELPKVSY.KALD..L.ACLLFGFASLV
Retrocopy
IVVLSWLSFWINPDTSAAGMPLGIFSVLSLASECTTLAAELPKVSYTKALDE*LVACLLFGFASLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide