RetrogeneDB ID:
retro_ecab_802
Organism:
Horse ( Equus_caballus )
Location:
4:19792127-19793509 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
94.16 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
Elongation factor 1-alpha [Source:UniProtKB/TrEMBL;Acc:F7BQJ6]

Genomic region (view in browser)





>retro_ecab_802
ATGGGCAAAGAGAAGACCCATATCAATACTGTCGTCATTGGCCATGTGGATCTGGCAAGT
CCACCACCATCGGGCACCTCATCTACAAGTGTGGGGGCATTGACAAGAGAACCATCGAGA
AGTTTGAGAAGGAAGCAGCAGAGATGGGCAAGGGCTCCTTCAAGTACGCCTGGGTGCTGG
ACAAGCTGAAGGCAGAGAGAGAACGTGGCATCACCACAGACATCTCCCTGTGGAAGTTTG
AAACCAGCAAATACTACATCACCATCATTGATGCCCCAGGCCACAGGGATTTCATCAAGA
ACATGATTACTGGCACTTCCCAGGCCGACTGCACCGTGCTCATCGTGGCCGCTGGCGTGG
GCGAGTTTGAGGCTGGCATCTCCAAGAACGGGCAGACCCGTGAGCATGCGCTACTGGCCT
TTACGCTGGGTGTGAAGCAGCTCATCGTGGCTGTCAACAAGATGGACTCAACTGAGCCTG
CCTACAGCGCCGCGCGCTTCCAGGACATCACCAAGGAAGTGAGCGCCTACATCAAGAAGA
TCGGCTACAACCTGGCCACCCTGGCCTTCGTGCCCATCTCGGGCTGGCACGGCGACAACA
TGCTGGAGCCCAGCACCAACATGCCCTGGTTCAAGGGCTGTAAGGTGGAGAGGAAAGAGG
GAAACGCCACCGGGGTGACTCTGCCGGAAGCTCTGGACTCCATCCTCCTGCCCACTCGCC
CGGTCAACAAGCCTCTGAGGCTGCCTCTGCAAGACGTGTACAAGATTGGAGGCATTGGCA
CTGTGCCTGTAGGCCGCGTGGAGACCGGCTTCCTGAAACCTGGGATGGTGGTCACCTTTG
CCCCCAGCAACCTCACCACCGAGGTCAAGTCTGTGGAGATGCACCACGAAGCCCTGACTG
AGGCCCTGCCTGGTGACAACGTGGGCTTCAACGTCAAGAATGTGTCTGTGAAGGACATCC
ATCGTGGAAATGTGGCTGGAGCCAGCAAGAACGACCCCCTCATAGAGGCTGGCAGCTTTG
TGGCACAGGTGATCATCTTGAACCACCCTGGGCAGATCCACGCCGGCTATACCCCAGTGC
TGGACTGCCATACAGCCCACATCTCTTGCAAGTTTGCTGAATTGAGGGAAAAGATTGACA
GGCGCTCAGGCAAGAAGCTGGAGGAAAACCCCAGGGCCCTGAAGTCGGGCGATGCAGCGA
TGGTGCAGATGGTCCCCAGCAAGGCCATGTGTGTGGAAACTTTCTCTGAGTACCCACCTC
TAGGCCGTTTTGCTTTGCGGGACATGAGCCAAACAGTGGCTGTTGGAGTCATCAAGACAG
TGGATAAGAAGTCAACCACAGCTGGCAAGGTCACCAAGTCAGCAGTAAAGGCGAGCAAGA
AG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKEKTYINIVVIGHVD-SGKSTTTGHLIYKCGGIDKRTIEKFEKEAGEMGKGSFKYAWVLDKLKAERERGITIDISLWKFETSKYYITIIDAPGRRDFI
MGKEKT.IN.VVIGHVD.SGKSTT.GHLIYKCGGIDKRTIEKFEKEA.EMGKGSFKYAWVLDKLKAERERGIT.DISLWKFETSKYYITIIDAPG.RDFI
Retrocopy
MGKEKTHINTVVIGHVD/SGKSTTIGHLIYKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITTDISLWKFETSKYYITIIDAPGHRDFI


Parental protein
KNVITGTSQADCAVLIVAGGVGEFEAGISKNGQTREHALLAFTLGVKQLIVAVNKMDSTEPAYSAARFQEITKEVSAYIKKIGYNPATVAFVPISGWHGD
KN.ITGTSQADC.VLIVA.GVGEFEAGISKNGQTREHALLAFTLGVKQLIVAVNKMDSTEPAYSAARFQ.ITKEVSAYIKKIGYN.AT.AFVPISGWHGD
Retrocopy
KNMITGTSQADCTVLIVAAGVGEFEAGISKNGQTREHALLAFTLGVKQLIVAVNKMDSTEPAYSAARFQDITKEVSAYIKKIGYNLATLAFVPISGWHGD


Parental protein
NMLEPSSNMPWFKGWKVERKEGNATGVTLLEALDSILPPTRPVNKPLRLPLQDVYKIGGIGT-PVGRVETGFLKPGMVVTFAPSNLTTEVKSVEMHHEAL
NMLEPS.NMPWFKG.KVERKEGNATGVTL.EALDSIL.PTRPVNKPLRLPLQDVYKIGGIGT.PVGRVETGFLKPGMVVTFAPSNLTTEVKSVEMHHEAL
Retrocopy
NMLEPSTNMPWFKGCKVERKEGNATGVTLPEALDSILLPTRPVNKPLRLPLQDVYKIGGIGTVPVGRVETGFLKPGMVVTFAPSNLTTEVKSVEMHHEAL


Parental protein
TEALPGDNVGFNVKNVSVKDIHRGNVAGDSKNDPPIEAGSFVAQVIILNHPGQIHAGYTPVLDCHTAHISCKFAELREKIDRRSGKKLEKNPKALKSGDA
TEALPGDNVGFNVKNVSVKDIHRGNVAG.SKNDP.IEAGSFVAQVIILNHPGQIHAGYTPVLDCHTAHISCKFAELREKIDRRSGKKLE.NP.ALKSGDA
Retrocopy
TEALPGDNVGFNVKNVSVKDIHRGNVAGASKNDPLIEAGSFVAQVIILNHPGQIHAGYTPVLDCHTAHISCKFAELREKIDRRSGKKLEENPRALKSGDA


Parental protein
AIVQMVPSKAMCVETFSEYPPLGHFAVRDMRQTVAVGVIKTVDKKSSTAGKVTKSAVKASKK
A.VQMVPSKAMCVETFSEYPPLG.FA.RDM.QTVAVGVIKTVDKKS.TAGKVTKSAVKASKK
Retrocopy
AMVQMVPSKAMCVETFSEYPPLGRFALRDMSQTVAVGVIKTVDKKSTTAGKVTKSAVKASKK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide