RetrogeneDB ID:
retro_ecab_805
Organism:
Horse ( Equus_caballus )
Location:
4:30197081-30197935 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.96 %
Coverage:
59.26 %
Frameshifts:
4
Stop codons:
5


Parental gene:
Parental gene symbol:
NT5DC2
Parental gene aliases:
No gene alias available
Parental gene description:
5'-nucleotidase domain containing 2 [Source:HGNC Symbol;Acc:25717]

Genomic region (view in browser)





>retro_ecab_805
GACCTGTATGGGGGCACCCACTCCCACTGTGGCAGATAGGCGGTTCCAACAGCAGAAGTC
CCTCCATCAAGCAGTTCGTAGATATGTCCTCGCTGCCGGAGACGGCACCGCTCTCCCAAG
TGGTGGACCGCTTCCTGGGCCACAACCTGGAGTTTGACCACGCTTGCCTCTACAAGAGTG
AGACAGATGCCGTTGGAGACGTGCACGTGAAGGGCCTCAAATACGAGTGGATCCAGTGGG
ACAGGGAGAAGTACATCTCCAAAGTGGAGGAAATATTCGCCGTCTTGAGCGCCTGGTCCA
TGGGAAACAGCTGGCCTCATCACCAACGGTGTTTTCTGCTTCGTGACAGGGGGATGTGGC
ACGTGGCGGATCACCACTGGCGTTGACTCTTCAAGGAAGTCATTATACAGGCAGATAAGC
CCAGACTTTTCACCTACTGGCGCAAGCCGTTCAGAAACCTCGATTAGAAGGGCTCACTCG
TGTGAGACTGTATCAGCGCCCTGGACAAGGGCGCGATCTATCGGCAGGGAAACCTTTTGG
ACTTCCTGTGCCTGATGGAATGGTGCGGTCTCTGCAAGTTGTCCTTCAGAAACCGCCTCT
ACAGTGACCTGGCGGAACTCCTGCTGCCGCACACCTGGCGTGAGGGCATCATCATCCCCA
AGCTGGAGTGCAAGACGCGCATCATCAACGCAGTGCAGAACCCGCACTCACTGACTCAGC
AGCGGCGTTCACCAGACTGCTTAGAGCACAGGCAGACCTTCCAGGACACAGAATCGCAGC
AGATGCGGGGTGCCTGGATGAAGGCATGAAAGGAGCTGAGGTGAATCACCGAAGTCCTGT
TCAACACTCAGTTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DLYGGTQH-IPLYQMSGFYGKGPSIKQFMDIFSLPEMALLSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILREDETFAVLS-
DLYGGT.H..PL.Q..G.....PSIKQF.D..SLPE.A.LS.VVD.FLGH.LEFD.A.LYK..TDA..DVHVKGL.Y.WI..D.EKYI....E.FAVLS.
Retrocopy
DLYGGT-H/LPLWQIGGSNSRSPSIKQFVDMSSLPETAPLSQVVDRFLGHNLEFDHACLYKSETDAVGDVHVKGLKYEWIQWDREKYISKVEEIFAVLS/


Parental protein
RLVAHGKQLF-LITNSPFSFV-DKGMRHMVGPDWRQLFDVVIVQADKPSFFTDRRKPFRKLDEKGSLQWDRITSLEKGKIYRQGNLFDFLRLTEWRGPRV
RLV.HGKQL..LITN..F.FV.D.GM.H.....WR.LF..VI.QADKP..FT..RKPFR.LD.KGSL..D.I..L.KG.IYRQGNL.DFL.L.EW.G...
Retrocopy
RLV-HGKQLA/LITNGVFCFV/DRGMWHVADHHWR*LFKEVIIQADKPRLFTYWRKPFRNLD*KGSLV*DCISALDKGAIYRQGNLLDFLCLMEWCGLCK


Parental protein
LYFGDHLYSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQTYQDAESRQVLAAWMKERQELRCITKALFNAQF
L.F...LYSDLA.L.L.H.WR.G.IIP.LE...RIIN..Q..HSLT.Q......LE..QT.QD.ES.Q...AWMK...ELR.IT..LFN.QF
Retrocopy
LSFRNRLYSDLAELLLPHTWREGIIIPKLECKTRIINAVQNPHSLTQQRRSPDCLEHRQTFQDTESQQMRGAWMKA*KELR*ITEVLFNTQF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide