RetrogeneDB ID:
retro_ecab_807
Organism:
Horse ( Equus_caballus )
Location:
4:31874048-31875299 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
86.67 %
Coverage:
50.24 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
CDCP1
Parental gene aliases:
No gene alias available
Parental gene description:
CUB domain containing protein 1 [Source:HGNC Symbol;Acc:24357]

Genomic region (view in browser)





>retro_ecab_807
TGCACGGACCACCGGTACTGCCACAAGAAGTCTTACCCACTCCGGGTGCCCAGCAACATC
CTCCAGCTGGCTGTGCAGCTGCACAGCTTCTCCTGGAAGCTGCTGGTGCCCAAGGACAGT
CTCAGCCTGGCACGGGTGCCAGTCCAGAAGCTGCAGCAGCACTCACACAAGAGGGCCTGC
AACACCAGCTTCAGCTACTTCGTGGCCAGTGCTGTTCCCGGCCAGGACCTTTACTTCTGC
TCCGGAGGCTCCAGTGAGCAGATCCAGGTGAAGCAGAACATCTCGGTGACTCTCCACACC
TTTGCCTCCAGCTTCCAACAGGATGTCTCCAGGCAGGGCCTGACCGTGTCCTTTAGACCG
TACTTCACAGAGGAAGCTGTTTTCACTGTGACCCTGGACATGAAAAGCAAGGTCTATCTG
AGGACCCCTAACTGGGACTGGGGCCTGCTGTCCCTCGCCTCGGTGTCCTGGAACATCAGT
GTGCCCAGAGACCAGGTGGCCTGCCTGACCTTCTTAAAGGAGTGGACTGACCTGGTCTGC
CAGACAGGGCGTGCATTCATGATCATCCAGGAGCAGCGGATGTGGGCTGAGGAGATCTTT
AGCCTGGAGGATGTGCTCCCCAAGCCAAGATTCCACCATCATGGTTTCTGGGTCAACATC
TCCAATTGCAGCCCTGTGAGCAGCAAGCAGCTGGACATGCTCTTCTGGGTGTCACTTTCC
CTGAGGACAACGGACGTGACTGTTGTCATCATTGCAGTGGTGGGAGGTGGCGCCTTACTG
ATGTTTGCCCTCGGACTCATCATTTGCCTCGTGAAAAAGAAGAGGAAAAAGGAGATAAAC
AAGGGCCCGGCCGTAGGTATCTACAATGGCAATGTCAATACCTAGACGCTGATGCAGCCA
AAAAAGTTTCAGAAGAGGTGAAAGGACAATGACTCCCATGTGTATGCAGTCATCGATGAC
ACTATGGTATATGGGCATCTGCTGCAGGATTCCAACAGGTCCTTCCTCCAGCCAGAGGTG
GACACCTACCAGCCCTTCCAGGGCCCCATGGGGGACTGCCCTCCCTCCCCACCCCCCGTA
TGCTCCAGGGCCCCGACTGTAAAGTTGATCATAGATGAACCACCCCCTGACATTCCTCCT
GAGTCTGAGAGCAAACCATGCATCTTCTCCCACCCCAACATAGAGAATGTAAGCAACGGG
AACACAGACATTCCCTTGCTGGATGCCCACAAGCCAGTGGAGCCGGGGGAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.02
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
CTDRRYCHKKSYPLQVPSNILQLPVQLHNFSWKLLVPKDSLSLVLVPVQKLQQHTYERACNTSFRYLVASAVPSQDLYFGSFCSGGSIEQIQVKQNISVT
CTD.RYCHKKSYPL.VPSNILQL.VQLH.FSWKLLVPKDSLSL..VPVQKLQQH...RACNTSF.Y.VASAVP.QDLY...FCSGGS.EQIQVKQNISVT
Retrocopy
CTDHRYCHKKSYPLRVPSNILQLAVQLHSFSWKLLVPKDSLSLARVPVQKLQQHSHKRACNTSFSYFVASAVPGQDLY---FCSGGSSEQIQVKQNISVT


Parental protein
LRTFSPSYQQDISRQGLTVSFRPYFTEEAVFTVTPDVKSKVYLRTPNWDRGLPSLASVSWNISVPRDQVACLTFLKERTGLVCQTGRAFMIIQEQRMRAE
L.TF..S.QQD.SRQGLTVSFRPYFTEEAVFTVT.D.KSKVYLRTPNWD.GL.SLASVSWNISVPRDQVACLTFLKE.T.LVCQTGRAFMIIQEQRM.AE
Retrocopy
LHTFASSFQQDVSRQGLTVSFRPYFTEEAVFTVTLDMKSKVYLRTPNWDWGLLSLASVSWNISVPRDQVACLTFLKEWTDLVCQTGRAFMIIQEQRMWAE


Parental protein
EIFSLEEVLPKPRFHHHSFWVNISNCSPVSGKQLDMLFWVLLSPRTTDMTVIIIAVVGGGALLMFALGLIICLVKKKKKKEINKGPAVGIYNGNVNTQMP
EIFSLE.VLPKPRFHHH.FWVNISNCSPVS.KQLDMLFWV.LS.RTTD.TV.IIAVVGGGALLMFALGLIICLVKKK.KKEINKGPAVGIYNGNVNT...
Retrocopy
EIFSLEDVLPKPRFHHHGFWVNISNCSPVSSKQLDMLFWVSLSLRTTDVTVVIIAVVGGGALLMFALGLIICLVKKKRKKEINKGPAVGIYNGNVNT*TL


Parental protein
MQSKKFQKRRKDNDSHVYAVIDDTMVYGHLLQDSNGSFVQPEVDTYRPFQGPTGDCPPSPPPIGFRAPTAKLTTDEPPPDIPPESESEPYTFSHPNKENV
MQ.KKFQKR.KDNDSHVYAVIDDTMVYGHLLQDSN.SF.QPEVDTY.PFQGP.GDCPPSPPP...RAPT.KL..DEPPPDIPPESES.P..FSHPN.ENV
Retrocopy
MQPKKFQKR*KDNDSHVYAVIDDTMVYGHLLQDSNRSFLQPEVDTYQPFQGPMGDCPPSPPPVCSRAPTVKLIIDEPPPDIPPESESKPCIFSHPNIENV


Parental protein
SNGNTDIPLLDAHKPAEPGE
SNGNTDIPLLDAHKP.EPGE
Retrocopy
SNGNTDIPLLDAHKPVEPGE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide