RetrogeneDB ID:
retro_ecab_813
Organism:
Horse ( Equus_caballus )
Location:
4:54796849-54797218 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.17 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL35
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L35 [Source:HGNC Symbol;Acc:10344]

Genomic region (view in browser)





>retro_ecab_813
ATGACTAAGATTAAGGTTTGAGACCTTCAAGGCAAGAAGGAGGAGGAGTTGCTAAAACAG
CTGAATGACCTGAAGGTAGAGCTGTCCCATCTGTGTGTTACCAAAGTGACAGGCAGTGCA
GTGTCCAAGCTCTCTAAGATCTGAGTTGCTCACATATCCATCACCATTGTTCTCACCGTC
GTTAACCAGACTCAGAAAAAGAACCTCAAGAAATTCTACGAGGGCAAAAAGTACAAGTCC
CTGGAACTGTGGCCCAAGAAAACATGTGCCATGTGCTGCTGGCTCAGCAAGCATGAGGAG
AACCTGAAGACCAAGAAGCAGGAGCAAAAGGAATGGCTGTACCCACTGTGGAAGTACGCA
GTCAAGGCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.05
SRP021940_embryo 0.12
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.08
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEE
M.KIK..DL.GKK.EELLKQL.DLKVELS.L.V.KVTG.A.SKLSKI.V...SI..VLTV.NQTQK.NL.KFY.GKKYK.L.L.PKKT.AM...L.KHEE
Retrocopy
MTKIKV*DLQGKKEEELLKQLNDLKVELSHLCVTKVTGSAVSKLSKI*VAHISITIVLTVVNQTQKKNLKKFYEGKKYKSLELWPKKTCAMCCWLSKHEE


Parental protein
NLKTKKQQRKERLYPLRKYAVKA
NLKTKKQ..KE.LYPL.KYAVKA
Retrocopy
NLKTKKQEQKEWLYPLWKYAVKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide