RetrogeneDB ID:
retro_ecab_814
Organism:
Horse ( Equus_caballus )
Location:
4:56002482-56002985 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.77 %
Coverage:
67.59 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
C1orf43
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 1 open reading frame 43 [Source:HGNC Symbol;Acc:29876]

Genomic region (view in browser)





>retro_ecab_814
ATGGCATCTGGCAGTAACTAGCTGTCCAGGGTGAATGCTGTGCTGGCGGAAGTCTACAGG
AACCTGGTATTTGTACTGCTACTTATTTTGGGGAAGAAGTAAACCATGTGCTTTGCAATG
GAAATCTCGAAGGGGACCTGATCTCCTTGTGGGACACGTGCCCTGAAGACTTGAAAGAGG
AGACTGACATTCAACTATCTAGGCTTCAGGATATCAAGTATGAACCCCAGCTCCTTGAGG
ATGATGGTGCAAGAATACTACAGTTAGAAACCCAGGGAAAGCAGAAGTGCCACAACTACC
TGTACAGGATGAAAGCTCTGGAAGCCACCGGGCCTCTGAGACACCATTTCAAGCTGAAGG
CTGGCATTCCTGGGGCAAGGATTTCTGCCCCTACCTGCTAGATCTTCGAAACACTAGTAC
TCCTTTTCAAGGGTGTGTGCAAGGCCCTCACTGATACCCTGCTGGATGGCTGAGACGGCC
CACTATGGGACATGGGTCTGTGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.1
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASGSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAM-KSRRGPHV-PVGHNA-PKDLKEEIDIRLSRVQDIKYEPQLLADDDARLLQLETQGNQNC
MASGSN.LS.VN.VL...Y..LVFVLL.I..K...M.FAM.KSRRGP...P.G..A.P.DLKEE.DI.LSR.QDIKYEPQLL.DD.AR.LQLETQG.Q.C
Retrocopy
MASGSN*LSRVNAVLAEVYRNLVFVLLLILGKK*TMCFAM\KSRRGPDL/PCGTRA/PEDLKEETDIQLSRLQDIKYEPQLLEDDGARILQLETQGKQKC


Parental protein
YNYLYRMKALDAI-RASEIPFHADGRHPCSLMGKNFRSYLLDLRNSSTP-FKGVRKALIDTLLDGYETARYGTGVF
.NYLYRMKAL.A..RASE.PF.A.G.H.....GK.F..YLLDLRN.STP.FKGV.KAL.DTLLDG........G..
Retrocopy
HNYLYRMKALEAT/RASETPFQAEGWHS---WGKDFCPYLLDLRNTSTP\FKGVCKALTDTLLDG*DGPLWDMGLW


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide