RetrogeneDB ID:
retro_ecab_815
Organism:
Horse ( Equus_caballus )
Location:
4:57345178-57345474 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
76.24 %
Coverage:
66.67 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RPS19
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S19 [Source:HGNC Symbol;Acc:10402]

Genomic region (view in browser)





>retro_ecab_815
GGCTGCGTGATGCCCGGAGTTGCCGTAAAAGACGCGAACCAGCAGTTCATCAGAGCTCTG
GCAGCCTTCCTTAAAAAGTCTGGGAAGCTGAAATCCCTGAGTGCACGGACACTGTCAAGC
TGGGCAAGCATAAAGAGCCTGCTCCCTACGATGAGAACTGCTTGTACACATGAGTTGCTT
CCACAGAGCGGCACCTGTACCTCCAGGCTGGCACTGGGGTTGGCTCCGTGACCAAGATCT
ATGGGGGACATCAGAGAAACAGTGTCATGACCAGCCACTTCAGCAGAGGCTCCAAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.1
SRP021940_embryo 0.12
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.05
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
GPQMPGVTVKDVNQQEFVRALAAFLKKSGKLK-VPEWVDTVKLAKHKELAPYDENWFYTRAASTARHLYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGS
G..MPGV.VKD.NQQ.F.RALAAFLKKSGKLK..PE..DTVKL.KHKE.APYDEN..YT..AST.RHLYL..G.GVGS.TKIYGG.QRN.VM.SHFSRGS
Retrocopy
GCVMPGVAVKDANQQ-FIRALAAFLKKSGKLK/IPECTDTVKLGKHKEPAPYDENCLYT*VASTERHLYLQAGTGVGSVTKIYGGHQRNSVMTSHFSRGS


Parental protein
K
K
Retrocopy
K


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide