RetrogeneDB ID:
retro_ecab_816
Organism:
Horse ( Equus_caballus )
Location:
4:63150482-63150815 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.28 %
Coverage:
98.26 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
ATP6V1G1
Parental gene aliases:
No gene alias available
Parental gene description:
ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864]

Genomic region (view in browser)





>retro_ecab_816
AGTCAGTTGAAAGGCATCTAGCAGCTGCAGGATGAGAAGTGGGCCACACAGAAGATGTCT
GAGGCCTACAAGCAAAAGAACCTGAAGCTGAAGCAGGACAAAGAAGCTTAGGCTGAAGTT
TAACCGTACCACCTGCAGGAGAAAGGGTTCAGGGCCAAGGAAGCTGTGCCTCTGGGATCC
CATGACAGCTGCAACACCGAAGTGGAGAAGGAGACCCAGGAGATGACCATCCTCCAGACC
TACTTCCGGCAGCACACGTATGAAGTTCCGGATAACCTCTTGGCCTTTGTTTGCAACATC
TGGCTAGAAATCCATGAAAACTACCACATAAAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SQSQGQQLLQSEKRAA-KVSEDRKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEAAALGSHGSCSSEVEKETQQKMSILQTYFRQNRDEVLDDLLAFV
SQ..G...LQ.EK.A..K.SE..K.KN..LKQ.KE.A.AE...Y.LQ.EK.F.AKEA..LGSH.SC..EVEKETQ..M.ILQTYFRQ...EV.D.LLAFV
Retrocopy
SQLKGI*QLQDEKWATQKMSEAYKQKNLKLKQDKE-A*AEV*PYHLQ-EKGFRAKEAVPLGSHDSCNTEVEKETQE-MTILQTYFRQHTYEVPDNLLAFV


Parental protein
CDIRPEIHENYRLN
C.I..EIHENY..N
Retrocopy
CNIWLEIHENYHIN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide