RetrogeneDB ID:
retro_ecab_818
Organism:
Horse ( Equus_caballus )
Location:
4:70391166-70391512 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.83 %
Coverage:
60.42 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
RPL9
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L9 [Source:HGNC Symbol;Acc:10369]

Genomic region (view in browser)





>retro_ecab_818
AGGCGCTTGCTACACATAGTTCCCACTCTCTGCCATCATGTCCAAAACATCATCAAGGCT
GGACACCGGTGTTTCGTTACAAGTGAGGTCTGGGTATACTCACTTCCCCAACGACGGGTT
CTTCAGGACAATGGGTCTCTTCTTGAAATCTGAAATTGCTTGGGTTAAAAATATATCCAC
AAGATTTGGATAAGGCCAGACCATTTCTTGTTCAGTATCTCAAGCTAAGAAAGATGAGTT
AATTCTTGAAGGAAACAGCTTTAAACTTGTATTGAATTCAGCTGCTTTAGTTGAAAAACC
CATGAGAGTTAAAAACAAGGATATCAGAAAGGTTTTGGATGGTATC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RKELATVRTICSHVQNMIK-GVTLGFRYK-MRSVYAHFPIN-VVIQENGSLVEIRNFLGEKYIRRVRMRPG-VACSVSQAQKDELILEGNDIELVSNSAA
R..L..V.T.C.HVQN.IK.G.T..FRYK..RS.Y.HFP....V.Q.NGSL.EI.N.LG.KYI.....RP....CSVSQA.KDELILEGN...LV.NSAA
Retrocopy
RRLLHIVPTLCHHVQNIIK/GWTPVFRYK/VRSGYTHFPND/RVLQDNGSLLEI*NCLG*KYIHKIWIRPD\ISCSVSQAKKDELILEGNSFKLVLNSAA


Parental protein
LIQQATTVKNKDIRKFLDGI
L......VKNKDIRK.LDGI
Retrocopy
LVEKPMRVKNKDIRKVLDGI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide