RetrogeneDB ID:
retro_ecab_82
Organism:
Horse ( Equus_caballus )
Location:
19:37029252-37030245 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
83.69 %
Coverage:
97.31 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
WDR5
Parental gene aliases:
No gene alias available
Parental gene description:
WD repeat domain 5 [Source:HGNC Symbol;Acc:12757]

Genomic region (view in browser)





>retro_ecab_82
ATGGCGGCGAAGGAGTCGGGCGATGCAGGAGCGGAGTCGGCCCTCTGCCCATCAGCCAAT
CCGAGCCAGCAAGCCTCTGAAAAACCAAACTATGCCCTCAAGTGTACTCTCGTGGGACAC
ACGGAAGCCGTATCATCAGTTAAGTTTAGTCCTAGTGGAGAATGGCTAGCAAGTTCTTCT
GCTGATAAAGTAATTATTATTTGGGGAGCCTATGATGGAAAATATGAGAAAACACTTTAT
GGTCACAGTCTGGAAATATCAGACGTTGCGTGGTCATCAGATTCCAGTCGTCTTGTTTCT
GCCTCAGATGATAAAACTCTAAAGATTTGGGATGTGAGATCTGGAAAATGTTTGAAAACG
CTGAAGGGGCACAGTAATTATGTTTTTTGCTGTAATTTCAATCCACCATCCAACCTCATC
ATTTCAGGATCTTTTGATGAGAGCGTGAAAATATGGGAGGTGAAAACAGGAAAGTGCCTC
AAGACTTTGTCTGCTCATTCTGACCCAGTTTCTGCTGTTCATTTTAATTGTAGCGGCTCC
TTGATAGTGTCAGGTAGCTATGATGGTGTCTGTAGAATCTGGGATGCTGCATCAGGTCAG
TGTTTAAAAATGCTTGTTGATGATGATAATCCTCCAGTCTCTTTTGTAAAATTTTCTCCG
AATGGTAAATATCTGCTCATTGCAACTTTGGACAATACTCTCAAACTATGGGATTATAGC
AGAGGCAGATGCCTGAAGACATACACGGGTCATAAGAATGAGAAATACTGCATATTTGCC
AATTTTTCAGTTACTGGTGGAAAGTGGATTGTGTCTGGTTCAGAGGATAACCTGGTTTAC
ATTTGGAACCTCCAGACTAAAGAGATTGTACAGACATTACAAGGTCATACAGATGTCGTA
ATCTCAGCAGCTTGTCATCCTACAGAAAACATCATTGCATCAGCAGCATTAGGAAATGAC
AGAACAATTAAACTGTGGACGAGTAACTACTAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 2.61
SRP021940_cerebellum 1.79
SRP021940_embryo 3.04
SRP021940_placental_villous 1.97
SRP021940_synovial_membrane 2.01
SRP021940_testis 1.84

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDD
E...A.A......SA..S.....KPNYALK.TL.GHT.AVSSVKFSP.GEWLASSSADK.I.IWGAYDGK.EKT..GH.L.ISDVAWSSDS..LVSASDD
Retrocopy
ESGDAGAESALCPSANPSQQASEKPNYALKCTLVGHTEAVSSVKFSPSGEWLASSSADKVIIIWGAYDGKYEKTLYGHSLEISDVAWSSDSSRLVSASDD


Parental protein
KTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKT
KTLKIWDV.SGKCLKTLKGHSNYVFCCNFNP.SNLI.SGSFDESV.IW.VKTGKCLKTL.AHSDPVSAVHFN..GSLIVS.SYDG.CRIWD.ASGQCLK.
Retrocopy
KTLKIWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDESVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGVCRIWDAASGQCLKM


Parental protein
LIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTA
L.DDDNPPVSFVKFSPNGKY.L.ATLDNTLKLWDYS.G.CLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQ.LQGHTDVVIS.A
Retrocopy
LVDDDNPPVSFVKFSPNGKYLLIATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQTLQGHTDVVISAA


Parental protein
CHPTENIIASAALENDKTIKLWKSD
CHPTENIIASAAL.ND.TIKLW.S.
Retrocopy
CHPTENIIASAALGNDRTIKLWTSN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide