RetrogeneDB ID:
retro_ecab_825
Organism:
Horse ( Equus_caballus )
Location:
5:22583309-22583820 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
71.43 %
Coverage:
78.08 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
AGPAT2
Parental gene aliases:
No gene alias available
Parental gene description:
1-acylglycerol-3-phosphate O-acyltransferase 2 [Source:HGNC Symbol;Acc:325]

Genomic region (view in browser)





>retro_ecab_825
ATCATCGGTTGATTCATCCAGCCCTTCAAGTACATTTATGGCCTTCACTTTGAGATCAAG
GGCCCCCAGAAGCTGGAGGTGGACAAGCCCTGTGTCATCATTTCAACTACCAGAGCATCC
TGATGTGATGGGCCTCATGGAGGACCTTTCCAAGCACTGTGTGCAGGTTGCCAAGTGAGA
GCTGCTCTTCCTGGGGCCCGTGGGCCTAACCATGTACCTCGGAGGCATCTTCTTCATCAA
CTGGCAGAGCTTTAGCACCGCTGTGACCGTGATGGCCAGATGTAGGCCAGCATATGGTCA
GGGAAAACCTCAAAGTGTGGATCTATGCAGAGGGCCCATGGAAAGACAATGAGGACCTGC
TGCCTTTCAAGAAATGTGCCTTCTACCTGGTGATCCAGGCCCAGGTGCCCATCATCCCCG
TGGTTGCTCCACCTGGTCCTCTTTCTACAGCTCCATGGTAAAGCTCTTCACCTCAGGAAC
AGTCAAGGTGGAAGTGCTGAACCCCATCCCC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IISWFVRSFKYAYGLRFEIKGRGKLEVDHPCVIIS-NHQSIL-DMMGLMEILPPRCIQIAKRELLFLGPLGLIMYLGGVVFINRQRSSTAMTVMA-DVGE
II..F...FKY.YGL.FEIKG..KLEVD.PCVIIS.N.QSIL.D.MGLME.L...C.Q.AK.ELLFLGP.GL.MYLGG..FIN.Q..STA.TVMA.DVG.
Retrocopy
IIG*FIQPFKYIYGLHFEIKGPQKLEVDKPCVIIS/NYQSIL/DVMGLMEDLSKHCVQVAK*ELLFLGPVGLTMYLGGIFFINWQSFSTAVTVMA\DVGQ


Parental protein
HLVREDLKVWIYPEGTRNDNGDLLPFKKGAFHLAIQAQVPIIPVV-YSSFSSFYNSRTKLFTSGTVKVEVLDAIP
H.VRE.LKVWIY.EG...DN.DLLPFKK.AF.L.IQAQVPIIPVV..S..SSFY.S..KLFTSGTVKVEVL..IP
Retrocopy
HMVRENLKVWIYAEGPWKDNEDLLPFKKCAFYLVIQAQVPIIPVV/CSTWSSFYSSMVKLFTSGTVKVEVLNPIP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide