RetrogeneDB ID:
retro_ecab_826
Organism:
Horse ( Equus_caballus )
Location:
5:27504031-27504398 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.0 %
Coverage:
50.21 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
ANP32B
Parental gene aliases:
No gene alias available
Parental gene description:
acidic (leucine-rich) nuclear phosphoprotein 32 family, member B [Source:HGNC Symbol;Acc:16677]

Genomic region (view in browser)





>retro_ecab_826
CAAGAACTTGTCCTAGACAATTGCAAATCAAATGATGGGAAAATTGAGGACCTAGCTGAA
TTAGTGAATTTGTGAACTGAGTTCCTCAGTTTAATAAATGTAGGCTTGATTTCAGTTTCA
GATTTCCTCAAACTCCCTAAATAGGGAAAGCTTGAGCTCAGTGACAATAGAATGTTTAGA
AGTCTAGACGTGTTCACAGAAAAACTTCCAAATCTCACCCATCAAAACGTTAAGTGGACA
TAAATTGAAAGATATAAGCACCTTGGAACCTTTGAAAAAGTTGGAATATTTGAAAAGCCT
GGATCTGTTTAAGTGTGAGGTTACTAAACTGAATGGCTACCGAGAATGTCTTCAAGCTCC
TGTCCCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RELVLDNCKSNDGKIEGLTAEFVNL--EFLSLINVGLISVSNLPKLPKLKKLELSDNRIFGGLDMLAEKLPNLTHLN-LSGNKLKDISTLEPLKKLDCLK
.ELVLDNCKSNDGKIE.L.AE.VNL..EFLSLINVGLISVS...KLPK..KLELSDNR.F..LD...EKLPNLTH.N.LSG.KLKDISTLEPLKKL..LK
Retrocopy
QELVLDNCKSNDGKIEDL-AELVNL*TEFLSLINVGLISVSDFLKLPK*GKLELSDNRMFRSLDVFTEKLPNLTHQN\LSGHKLKDISTLEPLKKLEYLK


Parental protein
SLDLFNCEVTNLNDYRESVFKLLP
SLDLF.CEVT.LN.YRE......P
Retrocopy
SLDLFKCEVTKLNGYRECLQAPVP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide