RetrogeneDB ID:
retro_ecab_83
Organism:
Horse ( Equus_caballus )
Location:
21:43218558-43219182 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.93 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
TAF11
Parental gene aliases:
No gene alias available
Parental gene description:
TAF11 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 28kDa [Source:HGNC Symbol;Acc:11544]

Genomic region (view in browser)





>retro_ecab_83
ATGCTCAAGGCCAACACGTCGCTCTCGGACAAAGATGGGGACACAAGTGTGTCAGGTGAG
ATGCCAGCTGTCCCCATGGTCCTCGGGGCCAACGACAAGGACGGAATCCCTGGAGACCAA
TTTAGGGAATTGAAGGAAGCCTCTGAAGACGAAGGCGAGCTCCGGTGTCCGGACGGCTCA
GATCTAATGGCAGGTGAAAGGGAAGACGCCTCATTATTTCCTCCTGCAGCCAAAAGACTA
AAAAGAAATACCAAAACAGAGAAGGAGACGAAAGAGAAAGTGGATGAAGAGGAGGTTCAA
AGGATGAAAATCCTGCTGTCGTCTTTGAGCGAGGAGCAGCAGAATCGTTATGAAATGTAT
CGCCGGTCAGCTTTCCGGCAAGAAACCATGAGAAGTCTGATCCAGACCACAGCGGGCAGG
TCGGTGTCCCAGAACGTGGTCATTGCCATGTCCGGAATGGCCAAGGTCTTCGTCGGGGAG
GTGGTAGAAGAGGCCCTGGACGTGTGCGAGAGGTGGGGGGAAACGCCCCCACTCCAACCG
AAGCATCTGAGGGAGGCTGTTCGGAGGTTGAACTCGAAGGGGCAAATTCCCAACGTCAAG
GGCAAGAAGATCCTATTCTTCTAG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.02
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDNACESPAEKGGETGESDETAAAPGGPGAADTDGIPEETDGDGDGDLKEAAAEEGELKSQDISDLRAVEREDSSLLTPAAKKLKIDTKDKKEKKQKVDE
M..A..S...K.G.T..S.E..A.P...GA.D.DGIP....GD....LKEA...EGEL...D.SDL.A.ERED.SL..PAAK.LK..TK..KE.K.KVDE
Retrocopy
MLKANTSLSDKDGDTSVSGEMPAVPMVLGANDKDGIP----GDQFRELKEASEDEGELRCPDGSDLMAGEREDASLFPPAAKRLKRNTKTEKETKEKVDE


Parental protein
DEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQI
.E.Q.M.IL.SS.SEEQ.NRYEMYRRSAF.......LIQ...G.SVSQNVVIAMSG..KVFVGEVVEEALDVCE.WGE.PPLQPKH.REAVRRL.SKGQI
Retrocopy
EEVQRMKILLSSLSEEQQNRYEMYRRSAFRQETMRSLIQTTAGRSVSQNVVIAMSGMAKVFVGEVVEEALDVCERWGETPPLQPKHLREAVRRLNSKGQI


Parental protein
PNSKHKKIIFF
PN.K.KKI.FF
Retrocopy
PNVKGKKILFF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide