RetrogeneDB ID:
retro_ecab_834
Organism:
Horse ( Equus_caballus )
Location:
5:45752298-45752550 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
97.62 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
NDUFA3
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa [Source:HGNC Symbol;Acc:7686]

Genomic region (view in browser)





>retro_ecab_834
ATGGCTGTGAGACTCGCCGCCTTCCTCAAGAATGCCTGGGCCAAGGAGCCGGTGCTGGTC
GCGTCCTTCACTATCGCGGGCCTTGCTATAATTCTGCCCATCCTCAGCCCTTACACCAAG
TACTCCATCATGATCAACAAGGCGACACCCTACACCTACCCAGTGCCCCTCCGAGATGAC
GGGAATATGTCCGATGTGCCCAGCCACCCCCAGGACCCCCAGGGCCCAAGCCTGGAGTGG
CTGAAGAAACTG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAARLAAFLKNAWAKEPVLVASFTIAGLAIILPILSPYTKYSIMINKATPYTYPVPLRDDGNMPDVPSHPQDPQGPSLEWLKKL
MA.RLAAFLKNAWAKEPVLVASFTIAGLAIILPILSPYTKYSIMINKATPYTYPVPLRDDGNM.DVPSHPQDPQGPSLEWLKKL
Retrocopy
MAVRLAAFLKNAWAKEPVLVASFTIAGLAIILPILSPYTKYSIMINKATPYTYPVPLRDDGNMSDVPSHPQDPQGPSLEWLKKL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide