RetrogeneDB ID:
retro_ecab_836
Organism:
Horse ( Equus_caballus )
Location:
5:57034715-57035052 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.7 %
Coverage:
88.28 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
UBA52
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin A-52 residue ribosomal protein fusion product 1 [Source:RefSeq peptide;Acc:NP_001229382]

Genomic region (view in browser)





>retro_ecab_836
ATGCAGATCTCTGTGAGACCCTGATGGGTAAGACTGTCACCCTTGAGGCTGAGCCCAGTG
ACACCACTGAGAATGTCAAAACCAAAATTCAAGATAAGGAAGGCATCCTACCTAGCCAGC
AGTGTCTGGCTTTTGTGGGTACCCACCTGGAGGATGGACGTACTCGCTCGGACTACAACA
TCCAGAAAAAATCCACCCTGAACTTGTTGCTTTGCCTGTCAGGTGGCATTAATGAGCCTT
CTTTCTGCCAGTTCCTCCAGAAATACAACTTTGACAAGATGATCTGTCCCAAGCGTTACC
TCTCTTGCACCCCCGTGATGTCAAATGTTACAAGCAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQIFVK-TLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKC
MQI.V..TL.GKT.TLE.EPSDT.ENVK.KIQDKEGI.P.QQ.L.F.G..LEDGRT.SDYNIQK.STL.L.L.L.GGI.EPS..Q..QKYN.DKMIC.K.
Retrocopy
MQISVR/TLMGKTVTLEAEPSDTTENVKTKIQDKEGILPSQQCLAFVGTHLEDGRTRSDYNIQKKSTLNLLLCLSGGINEPSFCQFLQKYNFDKMICPKR


Parental protein
YAR-LHPRAVNCRKK
Y...LHPR.V.C.K.
Retrocopy
YLS/LHPRDVKCYKQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide