RetrogeneDB ID:
retro_ecab_837
Organism:
Horse ( Equus_caballus )
Location:
5:58376774-58377592 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
57.04 %
Coverage:
81.25 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
LDHA
Parental gene aliases:
No gene alias available
Parental gene description:
L-lactate dehydrogenase A chain [Source:RefSeq peptide;Acc:NP_001138352]

Genomic region (view in browser)





>retro_ecab_837
AAGGGAGAAATGATGGATCTGTAGCACAGCAGCTTATTTCTTCAGACACCTAAAATTACG
GCAGATAAAGATTATTCTGTGACGGCCAACTCTAAGATTGTGATGGTAACTGCAGGAGTC
CCTCAGCAAGAGGGACAGTCATCTCAATCTGCCGCAGCGGAATGTGAATGGCTTCAAGTT
TATTACTCTCCCGATCACTGAGTATAGTCCTAAATGCATCATAATTACGGTTTCCAACCC
AGTGGGTATTCTCACACATGTTATCTGGAAAGTAAAAGTGGATTACCCAAGCACCATGCG
ATAGGAAGCCGGTGTAATCTGGAACCTGATAGATTTCACTATCCTAGAGCTGAAAAACTT
GGCATTCATCCCAGCAGCTGCCATGGATGGATTTGGCGAGAACATGGCGACTCAAGTGTG
GCTGCGTGGAGTGGAGTGAATGTGGCAGGCGTTTCTTTCCAGACTCTGAATCCAGAGATG
AGAATGGACGATGATAGTGAAAATTGGAGAGAAGTGCACAAGATGGTGGTTGAAAGTGCC
TGTGAAGTCATCAAGCTAAAAGGATATACCAACTGGGCTATGGGGTGAAGCGGGATTGAT
CTCATTGAATCCGCGTTTAAACTCTATCCAGGATTCACCCAGCGTCAGCGATGGTGAAGG
GGACGTGGGGCATTGAGAACGAAGTCTTCCTGAGCCCTGCACGCATCCTGAATGCTGGGG
GATTAACCAACATTATCAACCAGAAGCTGAAGGCTGATGAGGTCGCTCAGCTCAAGAAAA
GTGCAGATGCCCAGTGGGACATCCAGAAGGACCTACAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.2
SRP021940_embryo 0.57
SRP021940_placental_villous 0.4
SRP021940_synovial_membrane 1.46
SRP021940_testis 0.18

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KGEMMDLQHGSLFLRTPKIVSGKDYSVTAHSKLVIITAGARQQEG-ESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLVVSNPVDILTYVAWKIS-GFP-K
KGEMMDL.H.SLFL.TPKI...KDYSVTA.SK..........Q....S.LNL.QRNVN.FKFI......YSP.C....VSNPV.ILT.V.WK.....P.K
Retrocopy
KGEMMDL*HSSLFLQTPKITADKDYSVTANSK-IVMVTAGVPQQE\DSHLNLPQRNVNGFKFITLPITEYSPKCIIITVSNPVGILTHVIWKVKVDYP/K


Parental protein
NRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPVWSGVNVAGVSLKNLHPELGTDADKEHWKEVHKQVVDSAYEVIKLKGYTSWAIGLS
...IGS.CNL...RF.Y...E.LG.HP.SCHGWI..EHGDSSV..WSGVNVAGVS...L.PE...D.D.E.W.EVHK.VV.SA.EVIKLKGYT.WA.G.S
Retrocopy
HHAIGSRCNLEPDRFHYPRAEKLGIHPSSCHGWIWREHGDSSVAAWSGVNVAGVSFQTLNPEMRMDDDSENWREVHKMVVESACEVIKLKGYTNWAMG*S


Parental protein
VADLAESIMK-NLRRVHPISTMIKGLYGIKEDVFLSVPCILGQNGISDVVKVTLTPEEEARLKKSADTLWGIQKELQ
..DL.ES..K..L.R.HP.S.M.KG..GI...VFLS...IL...G........L...E.A.LKKSAD..W.IQK.LQ
Retrocopy
GIDLIESAFK/TLSRIHPASAMVKGTWGIENEVFLSPARILNAGGLTNIINQKLKADEVAQLKKSADAQWDIQKDLQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide