RetrogeneDB ID:
retro_ecab_838
Organism:
Horse ( Equus_caballus )
Location:
5:58704174-58704383 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
73.24 %
Coverage:
56.45 %
Frameshifts:
1
Stop codons:
0


Parental gene:
Parental gene symbol:
NDUFS6
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) [Source:HGNC Symbol;Acc:7713]

Genomic region (view in browser)





>retro_ecab_838
CGGCTGCTGGGCTGGAGCAGAGGGGCGGCGCCGAGCCCACCCGGGGTGCCAGGCACTTCA
GGGTGTGGACCTCACCGACTGGGGAGAAGGTCACGCACGCTGGCCAGGTTTATGATGATG
GAGACGACAAGAGGATTCGGTTTGTAGGGCATCAGAAAGAGGTGAATGAAAACTTCGCCA
CTGATTTGATAGCAGAGCAACCCATGAGT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.52
SRP021940_cerebellum 0.55
SRP021940_embryo 1.17
SRP021940_placental_villous 0.58
SRP021940_synovial_membrane 0.65
SRP021940_testis 0.71

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RLLGRGGGAALSLPG-GARCFGVRTSPTGEKVTHTGQAYGAEDYRRIRFVGRQKEVNENFAIDLIAEQPVS
RLLG...GAA.S.PG.GAR.F.V.TSPTGEKVTH.GQ.Y...D..RIRFVG.QKEVNENFA.DLIAEQP.S
Retrocopy
RLLGWSRGAAPSPPG/GARHFRVWTSPTGEKVTHAGQVYDDGDDKRIRFVGHQKEVNENFATDLIAEQPMS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide