RetrogeneDB ID:
retro_ecab_839
Organism:
Horse ( Equus_caballus )
Location:
5:60908345-60908984 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.41 %
Coverage:
51.18 %
Frameshifts:
5
Stop codons:
3


Parental gene:
Parental gene symbol:
FAM175B
Parental gene aliases:
No gene alias available
Parental gene description:
family with sequence similarity 175, member B [Source:HGNC Symbol;Acc:28975]

Genomic region (view in browser)





>retro_ecab_839
TTTGACAAGCATAGAGTAATGAAAGACACTGAGGTAATTTACAGGTTTATAATACACTTC
ACCCAGGCAGTGCGTGCAGATGTAGAAAAGAATGAGCAAGTTGTTGAATCTTGTCAGGCA
GAAGTGAACAAATTAAGAAGACAAATCAATCAGATGAAATGGAAAAGAACAAGAAAGACG
ATTGCAGCAGGCGATGCTAAGCAGACAGATGCTGTATGAAAGTTTGGAACCAGTGGTCAG
TCCTCGGATGCCCTAACTGGGTTTTTAGCTGAAGGTTGAAGTACACTGGGAGATGCAGAG
GATTCTGGTCCTCCTCCTTCTTATTCTGGTTTTTCACTCACACAGTCTGGAAAGTACTTT
GAGCCTTTCTCTATGTAAAGTAGTGTCTTTGTACCTTGACCTCAAGCCATGGGCTCTTCC
AATTATGCTTCCACCAGTGCCGGACTGAAGTATCCCAGAAGTGGAGAAGACTTTCTTCCT
TCCCAAAGAGTAGCTGGAGACAGACTTGAAGAATCAGATAAAAGTGATTACGAAAATTTG
ATTGATCTTACAGAGCTTTCTAATAGGGAATACTTACATTCAAGGAATTCAGGATACGTG
ACATATTCCCATGGGGTCTCCAGGAACACTCAGACCTCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FDKDGVMKDIRAIYQVYNALQEKVQAVCADVEKSERVVESCQAEVNKLRRQITQRK-NEKEQE-RRLQQAMLSRQMAPESLEPGFSPRMP-YSGFVAEGR
FDK..VMKD...I...Y.......QAV.ADVEK.E.VVESCQAEVNKLRRQI.Q.K..EK....RRLQQAMLSRQM..ESLEP..SPRMP...GF.AEG.
Retrocopy
FDKHRVMKDTEVI---YRFIIHFTQAVRADVEKNEQVVESCQAEVNKLRRQINQMK/MEKNKK/RRLQQAMLSRQMLYESLEPVVSPRMP/LTGFLAEG*


Parental protein
SPLGDAEASDPPPPYSD-FHSNNQESTLSHP-RMETSVFMPRPQAVGSSSYASTSAGLKYPGSGADLPPPRRAAADSAEESDDSDYEHLIDPTEPSNSEC
S.LGDAE.S.PPP.YS..FHS...ESTLS....M..SVF.P.PQA.GSS.YASTSAGLKYP.SG.D..P..R.A.D..EESD.SDYE.LID.TE.SN.E.
Retrocopy
STLGDAEDSGPPPSYSG\FHSHSLESTLSLS/SM*SSVFVP*PQAMGSSNYASTSAGLKYPRSGEDFLPSQRVAGDRLEESDKSDYENLIDLTELSNREY


Parental protein
SHSRDSRPMTHPDGGSRNTQTS
.HSR.S...T...G.SRNTQTS
Retrocopy
LHSRNSGYVTYSHGVSRNTQTS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide