RetrogeneDB ID:
retro_ecab_840
Organism:
Horse ( Equus_caballus )
Location:
5:63521740-63522157 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.14 %
Coverage:
64.22 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
SOD2
Parental gene aliases:
SOD2, Mn-SOD
Parental gene description:
superoxide dismutase [Source:RefSeq peptide;Acc:NP_001075986]

Genomic region (view in browser)





>retro_ecab_840
AGGCTTCTATACAGCCTCCCTGTCTTATCTTATGATTATGGTGCTCTGGGGCCTAACATT
AATGCACAAAGCAGGCAGCTGCACCACCGTCAACATCATGTCAATTGTGTGAATAACTTG
ACTCCTGCCAAGGAGAAATATAAAGGGCCCCTGGCAAAATATGATGTTATAATTCAGGTA
GCTCTTCAGCCTGCACTTAAGTTCAGTGGTGGAGGCCGTGCCACTCTTACCATTTTATGG
ACAAACCTAAGCCCTGTAGATGGTGGAGAGCCCAAACTGGAGTTGCTGGAAGCCAGCGAA
TGTTACTTTGTTTCCTTTGGTTAACTTAAGGAGAAGTTGACAGCTGTATCTGTTGGCATT
CAAGGTTCAGACTGGGATTGGCTTGCTTTCATTAAGTAACACAGATTGCAGCTTGTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 1.63
SRP021940_cerebellum 0.0
SRP021940_embryo 0.38
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RQKHSLPDLQYDYGALEPYINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELLDAIK
R...SLP.L.YDYGAL.P.INAQ..QLHH..HH...VNNL....EKY...LAK.DV..Q.ALQPALKF.GGG....TI.WTNLSP..GGEPK.ELL.A..
Retrocopy
RLLYSLPVLSYDYGALGPNINAQSRQLHHRQHHVNCVNNLTPAKEKYKGPLAKYDVIIQVALQPALKFSGGGRATLTILWTNLSPVDGGEPKLELLEASE


Parental protein
RDFGSFDKFKEKLTAVSAGVQGSGWGWLGFNKDQGRLQIV
..F.SF...KEKLTAVS.G.QGS.W.WL.F.K...RLQ.V
Retrocopy
CYFVSFG*LKEKLTAVSVGIQGSDWDWLAFIK*H-RLQLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide