RetrogeneDB ID:
retro_ecab_846
Organism:
Horse ( Equus_caballus )
Location:
5:91932916-91933704 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.88 %
Coverage:
50.48 %
Frameshifts:
6
Stop codons:
4


Parental gene:
Parental gene symbol:
SGOL1
Parental gene aliases:
No gene alias available
Parental gene description:
shugoshin-like 1 (S. pombe) [Source:HGNC Symbol;Acc:25088]

Genomic region (view in browser)





>retro_ecab_846
CAAATAATCACCAACATTTCTATGTACTTGAAAAATTACCCTGAGTACAATAGAATGTCA
GTGTTAGATGTAGAAAAATTCAAAGTGAGAGAAGCCTAAGACACCATCCTACAACTGAGA
AAGGAATTTTACTACCTTGAATGTCAGCTATTTGCTTTGAAAGAAAAATGCACTTCAGAA
CAAAGAGAAAAACCCTTCAAAACCAGTAAGTACTTCCCTTTTGAATGGACTCCAATAATA
ATGATGATTCCAAGGACTTATTAGTGAAGGGTTTACCTCAAGCTCCTCTCAGAAAGTTGC
CCTTCCAGAACAAAGAGAATCATTACAAATAGAAGAGCAATATCTGCTATTCCTCAAGAC
AGATTCGATTCGGCATATTCTAGTTCAGGTGAACATAATCTACTGACGTCTTTCACGGAA
CTCTCTCTCTCCATCCGCCGCAGTTTAGGGAAAAGCTTTAACGATCTTGGGAAATTCGAT
AACTTGGATGACTTTGAAATGAGTCATCTGTCAGGGAAGTCTTTTGACCTGGAAAGAATT
AAATCTGCAAACCCTCTAGGAGGTATACACATACTGAAAATGTAGAACAAAATGTTTGTC
GATGGAGCAAGGACAAAATTAACTTATTACCAAGGCTAATTTACCTAGAAAGAATTACTA
ACACGGAAGAAGTCATTTTCAGCAAAAATTTGAACAAACTAAAACTAAGCTTACAGACTC
ACAATGAAGAAAAAGATAAAAGAAAAGCTAACAGAAGGAGAAAATCAAAATGCGTTTCAA
GATACAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QIITNTSTLLKNYQDNNRMLVLALENEKSKVREAEDIILQLRKECYYLTCQLYTLKEKLTSQEAEG-TAQNQEVCLSEMDSNG-DNSRDLFVTDLPQVPL
QIITN.S..LKNY...NRM.VL..E..K.KVREA.D.ILQLRKE.YYL.CQL..LKEK.TS...E..T.QNQ.V....MDSN..D.S.DL.V..LPQ.PL
Retrocopy
QIITNISMYLKNYPEYNRMSVLDVE--KFKVREA*DTILQLRKEFYYLECQLFALKEKCTSEQREK/TLQNQ*VLPF*MDSNNNDDSKDLLVKGLPQAPL


Parental protein
-QEAHLPGPGESFQIEEQ-IPTIPNQDRQRFDLDSGEDKSTDNVLPRTVSLRRSLKKRFNNLCQFDTLDDFEISHLSGQSFELERIRFVDPLISVHI-PE
.Q...LP...ES.QIEEQ.I..IP..........SGE............S.RRSL.K.FN.L..FD.LDDFE.SHLSG.SF.LERI....PL...HI..E
Retrocopy
/QKVALPEQRESLQIEEQ/ISAIPQDRFDSAYSSSGEHNLLTSFTELSLSIRRSLGKSFNDLGKFDNLDDFEMSHLSGKSFDLERIKSANPLGGIHI/TE


Parental protein
NVEENVCQWNKDQINLSPKLIHPGKSTKTNEDIL-EYKSEPTKRKHRDAHGRK-EKRKANRRRKSKCISKYK
NVE.NVC.W.KD.INL.P.LI.....T.T.E.I....K.E.TK.K..D...RK..KRKANRRRKSKC.S.YK
Retrocopy
NVEQNVCRWSKDKINLLPRLIYLERITNTEEVIF/QQKFEQTKTKLTDSQ*RK\DKRKANRRRKSKCVSRYK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide