RetrogeneDB ID:
retro_ecab_847
Organism:
Horse ( Equus_caballus )
Location:
5:95544763-95545313 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.62 %
Coverage:
75.51 %
Frameshifts:
7
Stop codons:
3


Parental gene:
Parental gene symbol:
EIF4E2
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation initiation factor 4E family member 2 [Source:HGNC Symbol;Acc:3293]

Genomic region (view in browser)





>retro_ecab_847
AGCAAGTTCGAAGCATTGGAAGATGACGACGGTGGAGTCCCTGATCAGAATGAAGAAAAG
AGTACATAGAAGGATGATGAGAAGGAAAAAAACAGCATAAGGCAGGAGTCAGGCCTGCAG
CCAGAGCAAGGCTGTTGTCCCCGGGCCGCAGAGCATCCCCACAGTATGATACCCTTCCTG
GTGCTCCAGGAGAAACCCAGCCGTCCCTCGAGCCCGCAGAGCTACGAGCAGAATGTCAAG
CAGATTGGCCCCTTTGCCTCCATGGAGCAGGTATGCAGATTTTACAGGCATGTGGTACCT
CTCTGGACCCTGACAGGCCACAGTGACTTCCATCTCTTCAAAGAAGGAATTGAGCCCACA
TGGGAGGATGATGCACATAAAAATGGTGGTGGTAGATGATTTGGCTGTGGAAGGGCGTGG
CATCCTGTTGCTGGGAGAATCTCATTCCGGCCGCGTTGGGGGACAGTTCGGGGTCAGGGA
GGAGATCTGAGGGCCTGTGGTCTCCGTGAGGTTTCAGGAGGACAATATTTCAATATGGAG
TAGCCTGGCA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.05
SRP021940_placental_villous 0.18
SRP021940_synovial_membrane 0.1
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NKFDALKDDDSGDHDQNEENSTQKDGEKE-KAERDKSQGSSKRKAVVPGP-AEHPL-QYN-YTFWYSRRTPG-RPTSSQSYEQNIKQIGTFASVEQFWRF
.KF.AL.DDD.G..DQNEE.ST.KD.EKE.K.....SQ..S..KAVVPGP.AEHP..QY..Y..W.SRR.P..RP.S.QSYEQN.KQIG.FAS.EQ..RF
Retrocopy
SKFEALEDDDGGVPDQNEEKST*KDDEKE\KTA*GRSQACSQSKAVVPGP/AEHPH/QYD/YPSWCSRRNPA/RPSSPQSYEQNVKQIGPFASMEQVCRF


Parental protein
YSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKW-IIRLRKGLASRCWENLILAMLGE-QFMVGEEICGAVVSVRFQEDIISIWNKTA
Y.H.V....LTGHSDFHLFKEGI.P.WEDDA.KNGG....I.L.KG.AS.CWENLI.A.LG..QF.V.EEI.G.VVSVRFQED.ISIW...A
Retrocopy
YRHVVPLWTLTGHSDFHLFKEGIEPTWEDDAHKNGGGR/MIWLWKGVASCCWENLIPAALGD/QFGVREEI*GPVVSVRFQEDNISIWSSLA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide