RetrogeneDB ID:
retro_ecab_849
Organism:
Horse ( Equus_caballus )
Location:
5:6577572-6577979 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
54.74 %
Coverage:
81.44 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
ISCU
Parental gene aliases:
No gene alias available
Parental gene description:
iron-sulfur cluster scaffold homolog (E. coli) [Source:HGNC Symbol;Acc:29882]

Genomic region (view in browser)





>retro_ecab_849
CAGGAGCTGTTGCACCAGGCCCTCCTTGATCACAAGAAGGTTGTTGGTCATTTAGAGAAC
TTCAGCAATGAACAACTCCTTGACAAGGCATCCAAAAATGTTTGAACTAGATTGGCAAAT
GCTCCAGCTGGTAGTAACGTAGTGAAATTATAGATTCAGGTGAATGCAAAGGGAAGACTT
ATGGCTGCCTGGTTTAAAATACTTGGCTATGGTTCTGAAATTGATCGAAGCTCATTAGCC
ATTGATTAGGTTAAAGGAAAATGGTTGAAGAAACCATGGTTATCAAAAGCATAGACATTG
TCAAGGAACTATGCCTTCCTCCCAAGAAGCTGCACTGCTCCATGATAACTGATGATGCAG
TCACAGTGGCCCTGCTAGACTATAAACTGAAAAAGAGGAGACAGAGA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RELSAPARLYHXQVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGK-TVEEALTIKNTD
.EL...A.L.H..VV.H.EN..N...LDK.SKNV.T.L..APA...V.KL.IQV..KG....A.FK..G.GS.I..SSLA...VKGK..VEE...IK..D
Retrocopy
QELLHQALLDHKKVVGHLENFSNEQLLDKASKNV*TRLANAPAGSNVVKL*IQVNAKGRLMAAWFKILGYGSEIDRSSLAID*VKGK/MVEETMVIKSID


Parental protein
IAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKK
I.KELCLPP.KLHCSM...DA...AL.DYKLK.....
Retrocopy
IVKELCLPPKKLHCSMITDDAVTVALLDYKLKKRRQR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide