RetrogeneDB ID:
retro_ecab_851
Organism:
Horse ( Equus_caballus )
Location:
5:15127853-15128078 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.67 %
Coverage:
61.98 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_ecab_851
AAGGAGAAAACAAAGAAACACATCATAAAAAAGAAACTACATAATTCAATGGGTAGACCA
GAACACACAGGATGAGAAACAAATGAAATGCAGGAGAGCCAGAAAACAAGTGATAAAATA
GCAGCACTAAGCCCACATATATCCATAATCACACTAAATGTAAATAGATTGAATTCTCCA
ATAAAAAGACACAGAGTGGCAAGATGGATTAAAGAACAAGACCCG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.1
SRP021940_embryo 0.17
SRP021940_placental_villous 0.13
SRP021940_synovial_membrane 0.16
SRP021940_testis 0.24

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QEILKKALIPEKKKRWNKIPKYTRQETKELQENQKMSDKMATLSPHISIITLNVNGLNSSIKIHRVATWIKEQDP
.E..KK..I..K.......P..T..ET.E.QE.QK.SDK.A.LSPHISIITLNVN.LNS.IK.HRVA.WIKEQDP
Retrocopy
KEKTKKHIIKKKLHNSMGRPEHTG*ETNEMQESQKTSDKIAALSPHISIITLNVNRLNSPIKRHRVARWIKEQDP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide