RetrogeneDB ID:
retro_ecab_853
Organism:
Horse ( Equus_caballus )
Location:
5:25975861-25976740 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.12 %
Coverage:
96.07 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
PPP1CC
Parental gene aliases:
No gene alias available
Parental gene description:
protein phosphatase 1, catalytic subunit, gamma isozyme [Source:HGNC Symbol;Acc:9283]

Genomic region (view in browser)





>retro_ecab_853
TCCAAGCCTGGCAAGAATGTCCAGCTACAGGAGAATGAAATCAGAGGACTCTGCTTAAAG
TCTCGAGAGATCTTTCTCAGCCAGCCTATCCTACTAGAACTTGAAGCGCCACTCAAAATA
TGTGGTGATATCCAGGGGCAATACTATGATTTGCTTCAACTTCTCAAGTACGGTGGTTTC
CCACCCAGAAAGCAACTACTTGTTTCTTGGGGACTATGTGGACAGCGGGAAGCAGTCGTC
AGAGACTAGTGCCTCTTAATGGCTTCCAAAATCAAACATCCTGAGAATTTTTTTCTTCTC
AGAGAAAACCACGAATGTGCCAGCATCAATAGAATTTATGGATCTTATGATAAATGTAAA
AGAAGATATAACATTAAACTGTGGAAAACTTTCACAGGCTGCTTTAATTATTTACCAATA
GCAGTCATCGTGGATGAGAAAATATTCTGCTGTCATGGAGGTTTATCACCAGATCTTCCA
ACTGTGGAGGAGATTCGGTGAATTATGTGACCAACTGATGTACTGGATCAAGGTCTTCTT
TGCAATCTTTTGTGGTCTGACCCCAATAAAGATGTCTTAGGCTGGGGTGAAAATGACAGA
GCAGTGTCCTTCACATTTGATGCAGAAGTAGTTGCAAAATTTCTCCTTAAGCATGATTTG
GATCTTATATGTAGAGCCCATCAGGTGGCTGAAGATGGATATGAATTTTTTGCAAAGAGG
CAGTTGGTCACTCTGTTTTCTGCACCCAGTTATTATGGCAAGTTTGATAACGCAGGTGCC
ATGATGAATGTGGACAAAACACTAATGTGCTCTTTTCAGGTATTAAAGCCTGCAGAGAAA
AAGAAGCTGAATGCCACGAGACCCGTAACACCTCCAAGG

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.12
SRP021940_cerebellum 0.15
SRP021940_embryo 0.19
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.13
SRP021940_testis 0.3

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFP-PESNYLFLGDYVDRGKQSLETI-CLLLAYKIKYPENFF
SKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDI.GQYYDLL.L..YGGFP.PESNYLFLGDYVD.GKQS.ET..CLL.A.KIK.PENFF
Retrocopy
SKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIQGQYYDLLQLLKYGGFP\PESNYLFLGDYVDSGKQSSETS/CLLMASKIKHPENFF


Parental protein
LLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGEN
LLR.NHECASINRIYG.YD.CKRRYNIKLWKTFT.CFN.LPIA.IVDEKIFCCHGGLSPDL...E.IR.IM.PTDV.DQGLLC.LLWSDP.KDVLGWGEN
Retrocopy
LLRENHECASINRIYGSYDKCKRRYNIKLWKTFTGCFNYLPIAVIVDEKIFCCHGGLSPDLPTVEEIR*IM*PTDVLDQGLLCNLLWSDPNKDVLGWGEN


Parental protein
DRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPR
DR.VSFTF.AEVVAKFL.KHDLDLICRAHQV.EDGYEFFAKRQLVTLFSAP.Y.G.FDNAGAMM.VD.TLMCSFQ.LKPAEKKK.NATRPVTPPR
Retrocopy
DRAVSFTFDAEVVAKFLLKHDLDLICRAHQVAEDGYEFFAKRQLVTLFSAPSYYGKFDNAGAMMNVDKTLMCSFQVLKPAEKKKLNATRPVTPPR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide