RetrogeneDB ID:
retro_ecab_859
Organism:
Horse ( Equus_caballus )
Location:
5:49662928-49663160 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
80.25 %
Coverage:
56.83 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
UBE2D3
Parental gene aliases:
No gene alias available
Parental gene description:
ubiquitin-conjugating enzyme E2D 3 [Source:HGNC Symbol;Acc:12476]

Genomic region (view in browser)





>retro_ecab_859
TCTACAGGTCCAGCTGGGGATGATGAGTTTCACTGGCGAGCCACAATTATGGAACCCAAT
GACAGCACATATCAAGGCAATGTATTTTTTTAACAATTCATTCTCCTACAGACTACCCCT
TCAAATCACCTAAGGTTGCATTTACAAGAATTTATTATCAAATATTAACAATAATGGCAG
CATTTGTCTTGATATTCTAAGATCACAGTGGTCTCTTGCTTTAACTATTTCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.17
SRP021940_cerebellum 0.05
SRP021940_embryo 0.19
SRP021940_placental_villous 0.09
SRP021940_synovial_membrane 0.34
SRP021940_testis 0.06

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SAGPVGDDMFHWQATIMGPNDSPYQGGVFF-LTIHFPTDYPFKPPKVAFTTRIYHP-NINSNGSICLDILRSQWSPALTIS
S.GP.GDD.FHW.ATIM.PNDS.YQG.VFF.LTIH.PTDYPFK.PKVAFT.RIY...NIN.NGSICLDILRSQWS.ALTIS
Retrocopy
STGPAGDDEFHWRATIMEPNDSTYQGNVFF/LTIHSPTDYPFKSPKVAFT-RIYYQ/NINNNGSICLDILRSQWSLALTIS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide