RetrogeneDB ID:
retro_ecab_860
Organism:
Horse ( Equus_caballus )
Location:
5:50543917-50544694 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.02 %
Coverage:
58.65 %
Frameshifts:
5
Stop codons:
7


Parental gene:
Parental gene symbol:
EIF3E
Parental gene aliases:
No gene alias available
Parental gene description:
eukaryotic translation initiation factor 3, subunit E [Source:HGNC Symbol;Acc:3277]

Genomic region (view in browser)





>retro_ecab_860
GCAGAGTAGGACCTGACTTCTCACATGGTGCATTATTTGGATTGAGATCTGAACTTTCCT
GTGATTGAATTTCTTTTAATGAAGAAGATATATGGTGAAAAATAAGTATTGTGAGGAAAA
TCAGATCTCTTTAGTGATTCTAATGTGGTAAACTCTGCTATGGACATTTACAAAAACCTT
TATTCTAATGATATCTTCATGCTTTGAGAGAAAAAAACACCATAGTTGTTGCACAACTGA
AACAGCTTCAAGCAGAAATGGACCAATTGTGGAAACGTTTGAACATCACAGCACTACAAG
GTCAATGGCAGTCAACAAGAGGTGGCTGGATGCTGTTTGACCACCTAGCTGACCAGCAGA
GTATTAAGCAGAAACATTTAGATAGGATCTCAGGTTTGCAAAATTCCAGTATGAATGTGC
CAATTACTCAGGAGCAGCAAGGTATCTTTGCTTTTTTAGAGAGTTTGATTCAGTAATGGA
TAGAAATGCTTTGGGTTCACTCTGAGGAAAATGGGCCTCTGAAATCTTCACGCAGCCATG
GAAGGCCTTGCATAATGAAAAGAGACCACAGATCCACAGATAAAAAAATTCTGTCATTCC
TCTATTCTTGTCTCATCAGCAGTGAACATGGCTCATTCACTGGTCTCTTTGTTCTCTTCA
GTCAGCCCCAAGGCAGTTAATAACATTATTAATCTTTTCATTTACCAGCCACAGTATCTT
AAAGCAATTCAGACCATATGTGCACATATTCTCCACTATTTGACTATGGTAGTCATA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDI-PHALREKRTTVVAQLKQLQAETE-PIVKMFEDPE
AE.DLT....H.LD..L.FP..EFL..K.IY.EK..L.GK.DL.SD.N.V..AMD.YKNLYS.DI..HALREK.T.VVAQLKQLQAE...PIV..FE...
Retrocopy
AE*DLTSHMVHYLD*DLNFPVIEFLLMKKIYGEK*VL*GKSDLFSDSNVVNSAMDIYKNLYSNDI/LHALREKNTIVVAQLKQLQAEMD/PIVETFEHHS


Parental protein
TTRQM-QSTRDGRMLFDYLADKHGFRQEYLDTL-YRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETID
TTR.M.QSTR.G.MLFD.LAD.....Q..LD....R.AKFQYEC.NYSGAA.YL.FFR......DRNAL.SL.GK.ASEI..Q.W..A.....R......
Retrocopy
TTRSM\QSTRGGWMLFDHLADQQSIKQKHLDRI/LRFAKFQYECANYSGAARYLCFFREFDSVMDRNALGSL*GKWASEIFTQPWK-ALHNEKRPQIHR*


Parental protein
NNSVSSPLQSLQQRTWLIHWSLFVFFNHP-KGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVI
.NSV.....S.QQ.TWLIHWSL......P.K...NII.LF.YQPQYL.AIQT.C.HIL.YLT..VI
Retrocopy
KNSVIPLFLSHQQ*TWLIHWSLCSLQSAP/KAVNNIINLFIYQPQYLKAIQTICAHILHYLTMVVI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide