RetrogeneDB ID:
retro_ecab_862
Organism:
Horse ( Equus_caballus )
Location:
5:69095771-69097401 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
73.1 %
Coverage:
90.89 %
Frameshifts:
5
Stop codons:
10


Parental gene:
Parental gene symbol:
PAPSS1
Parental gene aliases:
No gene alias available
Parental gene description:
3'-phosphoadenosine 5'-phosphosulfate synthase 1 [Source:HGNC Symbol;Acc:8603]

Genomic region (view in browser)





>retro_ecab_862
ATGGTTTGCCTTGCTATTCCATGCTGCACTTTGGATGGTGACAACATTCATCAAGGTCTC
AATAAAAATCTTGGCTTTAGTCCTGAAGACAGAGAAGAGAATTTCAATGCATTACAGGGG
TTGCTAAACTATTTGCAGATGTGGGCTTAGTGTGCATCGCAAGTTTTATATCGCTTTATA
CTCAGGATCACAGCAATGCAAGGCAAATTCATGAGGGTGCAAATTTACCTTTTTCTAAAC
TATTTGTTGATGCTCCTAAGCATGTTTGTGGACAGAGAGATGTCAAAGAACTCTACAGAC
AAGCATGGGCTGGAGAAATTAAAGATTTCACTGGGATTGATTCTGAATGTGAAAAACCAA
GACCCCTGAATTAGTGTTGAAAATAGACTCCTGTGATATAAATGACTGCATCCAGCAAAT
TGTGAAACTTCTACAGGAATGGGATATCATACTCATGAATACCTCTTATGAAGTAAAAGA
ACTGTATGTGCCAGAAAATAAACTACATTTGTCAAAAACAGATGCAGAAACATTACTGGC
ACTGAAAATTAGTAAGTGGATATGCAGTGGGTACAGATTTTGTGGAAGGTTGGGAAACCC
CACTGAATGACTTTATGAGAGAGAAAGAGTACTTACAATGCCATCATTTCGATTGTCTTC
TGGATGGGGGTGTCATGAACTTGCCAGTGCCTATAGTTCTGATAGCTATTCATGAAGATA
AAGAGAGGCTAGATGGTCAAACAGCATTTGCTCTGATGTAGGAGGGCTGCTATCTGGCTA
TTTTTCACAGTTCAAAGTTCTTTGAGCACAGGATGGAAGAGTGCTGTGCCAGACAGTGGG
GAACAACGTGCAAGAACCAACCCTACATCAAGATGGTTATGGAACAAGGAGGTTGGCTGA
TTGGAAGAGATCTTCAAGTCTGGGACCAAGTTCATTGGAATGATGGTCTTGGTTAGTATT
GTTTTACTCCGCCCGAGCTAAAGCAGATGTTTAAAGGTATGAATGCTGATGCTATCTTTG
CATTTCAATTACATAAGCCATTGCTCAACAGACATGCTCTATTAATGCAGGATACCCATT
AGCAATTTCTAGAGAGGGGCTACTGGCACCTTGTCCTTTTCAATCACTTTCTTGATGGCT
AGACAAAGGATGATGATGTTCCTTTGGTGTAGTTCTTGAAGCAGCATGCTGCAGTGCTGA
AGGGAGGAGTTCTGAATCCTGAAACAACAGTGATGCCATTTTCCTATCTCCCATGGTGTA
TGCTGGATCACCTGATGTCCAGTGGCATTGCAGAGCACGGATGGTTGCAGGAATCAATTT
TTACATTATAGGGTGAGACCCTGAGGGTGTGCCTCGTCCAGAAGCAGGGAAGGATCTTTA
TGAACCAATTCATGACACCAAAGTGCCGACAATTGCCCCTGGCCTAATCATCTTGGAAAT
GATTGCAACTTAAAACAAGCAAAAGAAGCATATGGACTACTATGACTCTGAACACCATGA
AGACTTTGAATTTATTTCAAGAACACATATGTGCAAACTTAGCTGAGAAGGCCAGAAGTT
TCCTGAAGTTTTTGTGACTCCCAAGGCCTAGGCTGTGCTGATGGAATACTAGAAATACTT
GGAGAAAGCT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
LVCHGIPCYTLDGDNIRQGLNKNLGFSPEDREENVRR-IAEVAKLFADAGLVCITSFISPYTQDRNNARQIHEGASLPFFEVFVDAPLHVCEQRDVKGLY
.VC..IPC.TLDGDNI.QGLNKNLGFSPEDREEN....I..VAKLFAD.GLVCI.SFIS.YTQD..NARQIHEGA.LPF...FVDAP.HVC.QRDVK.LY
Retrocopy
MVCLAIPCCTLDGDNIHQGLNKNLGFSPEDREENFNA/ITGVAKLFADVGLVCIASFISLYTQDHSNARQIHEGANLPFSKLFVDAPKHVCGQRDVKELY


Parental protein
KKARAGEIKGFTGIDSEYEKP-EAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKINK-VDMQWVQVL-A
..A.AGEIK.FTGIDSE.EKP...PELVLK.DSCD.NDC.QQ.V.LLQE.DI.....SYEVKELYVPENKLHL.KTDAETL.ALKI.K.VDMQWVQ.L..
Retrocopy
RQAWAGEIKDFTGIDSECEKP/KTPELVLKIDSCDINDCIQQIVKLLQEWDIILMNTSYEVKELYVPENKLHLSKTDAETLLALKISK/VDMQWVQIL/V


Parental protein
EGWATPLNGFMREREYLQCLHFDCLLDGGVINLSVPIVLTATHEDKERLDGCTAFALMYEGRRVAILRNPEFFEHRKEERCARQWGTTCKNHPYIKMVME
EGW.TPLN.FMRE.EYLQC.HFDCLLDGGV.NL.VPIVL.A.HEDKERLDG.TAFALM.EG...AI.....FFEHR.EE.CARQWGTTCKN.PYIKMVME
Retrocopy
EGWETPLNDFMREKEYLQCHHFDCLLDGGVMNLPVPIVLIAIHEDKERLDGQTAFALM*EGCYLAIFHSSKFFEHRMEECCARQWGTTCKNQPYIKMVME


Parental protein
QGDWLIGGDLQVLDRIYWNDGLDQYRFTPTELKQKFKDMNADAVFAFQLRNPVHNGHALLMQDTHQQLLERGYRRPVLLLHPLGGWTKDDDVPLMWRMKQ
QG.WLIG.DLQV.D...WNDGL..Y.FTP.ELKQ.FK.MNADA.FAFQL..P..N.HALLMQDTH.Q.LERGY...VL..H.L.G.TKDDDVPL....KQ
Retrocopy
QGGWLIGRDLQVWDQVHWNDGLG*YCFTPPELKQMFKGMNADAIFAFQLHKPLLNRHALLMQDTH*QFLERGYWHLVLFNHFLDG*TKDDDVPLV*FLKQ


Parental protein
HAAVLDEGVLNPATTVV-AIFPSPMMYAGPTEVQWHCRARMVAGANFYIVGRDPAGLPHPETGKDLYEPTHGAKVLTMAPGLITLEIVPFRVAAYNKKKK
HAAVL..GVLNP.TTV..AIF.SPM.YAG...VQWHCRARMVAG.NFYI.G.DP.G.P.PE.GKDLYEP.H..KV.T.APGLI.LE......A..NK.KK
Retrocopy
HAAVLKGGVLNPETTVM/AIFLSPMVYAGSPDVQWHCRARMVAGINFYIIG*DPEGVPRPEAGKDLYEPIHDTKVPTIAPGLIILEMI----AT*NKQKK


Parental protein
QMDYYDSEHNEDFEFISGTRMRKLAREGQKPPEGFMAPKAWTVLMEYYKSLEKA
.MDYYDSEH.EDFEFIS.T.M.KL..EGQK.PE.F..PKA..VLMEY.K.LEKA
Retrocopy
HMDYYDSEHHEDFEFISRTHMCKLS*EGQKFPEVFVTPKA*AVLMEY*KYLEKA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide