RetrogeneDB ID:
retro_ecab_864
Organism:
Horse ( Equus_caballus )
Location:
5:71703327-71703927 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.95 %
Coverage:
56.67 %
Frameshifts:
3
Stop codons:
6


Parental gene:
Parental gene symbol:
AMZ2
Parental gene aliases:
No gene alias available
Parental gene description:
archaelysin family metallopeptidase 2 [Source:HGNC Symbol;Acc:28041]

Genomic region (view in browser)





>retro_ecab_864
CAGTTCTTAAAAGAGAAGAAACCTAAAGATGCCTTCTGTGTTGTGGGAAAACAATGGTTG
AGCTTTACCAAAGAGACCACTAGAATTTTGTCTTTGAACACACCCCTTTGACAGATGGTG
TGGGGATATTAGCTTTGCCGCGTATGGCAATTTTTATAGCTCATGCTATGAAGGCAAAGT
AAAGAAGCTGCAGAAAATATCTTCAAGTGACTCTTCGATTTTTGATAAGTATTACATTCC
TGAAGTGACTAGTGTTTTGCTGCTTCGATCCTGTAAGACTTGACCTATGAGATTGGACAC
AGATTTGGACTTTGACACTGCCAGTGGCTTGCATGCCTAACATAAGGCTTCAGCCACTTG
GAAGAAGCTGCCTGGAGCCCCCTAAACCTTTGTCCTATCTGTTTACACAAGTTGCAGTGT
GCTATTGGTTTCAACCTTACAGAAAGATAGAAAGTGCTGGTGAGGTAGATTGACAAACCT
GCTGACAAAGCTGGAGTCCCTGAGAAACGTAGTGAGGATAATGTGAATTTGCCAAAACCT
GTTGAAGCCTTTAAGGAATGGAAAGAATGGATAATAAAATGCCTTGCTGTTCTCTAAAAA

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.0
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KFLKKKKPGDAFCIVGV-TMIDLYPRDSWNFVFGQASLTDGVGIF-SFARYGSDFYSSRYEGRVKKPQKVSSSDYSVFDNYYIPEVTSVLLLRSCKT-LT
.FLK.KKP.DAFC.VG..TM..LY.RD..NFVF....LTDGVGI..SFA.YG..FYSS.YEG.VKK.QK.SSSD.S.FD.YYIPEVTSVLLLRSCKT.LT
Retrocopy
QFLKEKKPKDAFCVVGK/TMVELYQRDH*NFVFEHTPLTDGVGIL/SFAAYGN-FYSSCYEGKVKKLQKISSSDSSIFDKYYIPEVTSVLLLRSCKT/LT


Parental protein
HEIGHIFGLRHCQWLACLMQGSNHLEEADRRPLNLCPICLRKLQCAIGFNIVERYKALVRWIDGASADTPRVTPKHSREDDVNLPKPVEAFKEWKEWIIK
.EIGH.FGL.HCQWLACL..G..HLEEA...PLNLCPICL.KLQCAIGFN..ER.K.LVR.ID...AD...V..K.S.ED.VNLPKPVEAFKEWKEWIIK
Retrocopy
YEIGHRFGL*HCQWLACLT*GFSHLEEAAWSPLNLCPICLHKLQCAIGFNLTER*KVLVR*ID-KPADKAGVPEKRS-EDNVNLPKPVEAFKEWKEWIIK


Parental protein
CLAVLRK
CLAVL.K
Retrocopy
CLAVL*K


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide