RetrogeneDB ID:
retro_ecab_865
Organism:
Horse ( Equus_caballus )
Location:
5:72674387-72675756 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
63.1 %
Coverage:
93.24 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
LPCAT2
Parental gene aliases:
No gene alias available
Parental gene description:
lysophosphatidylcholine acyltransferase 2 [Source:HGNC Symbol;Acc:26032]

Genomic region (view in browser)





>retro_ecab_865
ATCATCCTCACCGGGAGTGTGCTGGTGCCCGTTCGGGTGTCCTGCATCGCCTTCCTCTTC
ATCTTCCTCTGGCCAGTGGCCATACTTTCCACCGTGGGCCTTTCGGCTCAACCAACCAAG
CCCGCTAAGAGTTGGAGAAGAACACTAATGCAGTCAGCCCTCAAGTTCTTGTTTCAGGCG
ACGTTCTTTTTAGCAGGGTTCCTGGTTAAAGTGAAAGGGAAAAAGGCAACCCGAGACGAG
GCCCCCATCTTCGTGACAGCGCCGCACTCTACTTTCTTTGACGCTATCGCCTGTGTGGTG
GCAGGGTTACCCTCAGTGGTCTCCGCAAGTCAAAACGCGCTGATCCCTGTGGCTGGGAAA
CTCCTACTGTCAACACAGCCCGTGCTTGTGACGCGAGAGGACCCAAATTCCAGGAAGAAT
ACCAAGAATGAAATCCTGAGGCGAGTGACATCTGAAAGGAAGTGGCCACAGATCCTCATT
TTCCCGGAAGGAGTGTGTACCAATCGCACGTGTCTGGTCACCTTTAAACTAGGAGCCTTC
TCTCCAGGTGTTCCTGTGCAGCCAGTGCTGCTCAGGTACCCAAACACGCTGGACACGGTG
ACCTGGACCTGGCAGGGTTTCACAGGCTTCCAGGCCTGTATGCTGACCCTGAGTCAACTC
TTCACCAGGGTAGAAGTGGAGTTTATGCCTGTTTATATCCCAAATGACCAAGAAAAAAAA
GACCCGGTCCTTTTTGCCAATACAGTGAGGATCAACATGGCAAATGCTCTGGGGGTGCCT
GTGACAGACCACACTTATGAAGACTGCAGACTGATGATTTCCACAGGTAACCTTCAACTA
CCCACGGAAGCTGGTTTGGTGGGATTTACAAAAATTAGCCAGAAATTGAAGTTAGATTGG
GATAATATTCATCAGCATTTGGATGAATATGCTGCAATTGCAGTTGCCTCAAAAGGAGGG
AAGATAGAAATTGAAGTTTGCAAATTATTTAAAACTCCCAATTTAAGAGCCCTTGAGACA
ACTTTTTGCCCTCTTTGACAGGAATAATGAGGGCAGCATAGACCTCAGAGAGTATGTGAT
AGGTCTGACTGTCCTATGCAATTCCGCCAACACTGAAAAGATTCTGCAAATGTCATTTAA
GTTTTTTGATCTTGATGAGCATGGTTTTATAACAAAACAGGAGTTAGCTGCTACACTTTG
GACAGCTTTTGGAGTGCCAGATCTTGACGTTTCCAGACTCTTTCAGGAAATAGCTGGACA
GAGCTCAGAGTCCATTTCATACGAGAAGTTTAAGAAATTTGCCCTGAGGCATCCACAATA
TGCCAAGTTATTTAATTCATACTTAGATCTTCAGGCAGCCTATATATAT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.0
SRP021940_embryo 0.05
SRP021940_placental_villous 0.04
SRP021940_synovial_membrane 0.0
SRP021940_testis 48.42

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IFFLGIILLPIRALLVALILLLAWPFAAISTACCPEKLTHPVTGWRRKITQPVLKFLGRALFFSMGFIVTVKGKVANAVEAPIFVVAPHSTFFDGIACVI
I...G..L.P.R....A......WP.A..ST.......T.P...WRR...Q..LKFL..A.FF..GF.V.VKGK.A...EAPIFV.APHSTFFD.IACV.
Retrocopy
IILTGSVLVPVRVSCIAFLFIFLWPVAILSTVGLSAQPTKPAKSWRRTLMQSALKFLFQATFFLAGFLVKVKGKKATRDEAPIFVTAPHSTFFDAIACVV


Parental protein
AGLPSMVSRNENAQAPLVGRLLRALQPVLVSRVDPDSRKNTINEIIRRATSGGEWPQMLVFPEGTCTNRSCLITFKPGAFIPGVPVQPILLRYPNKLDTV
AGLPS.VS...NA..P..G.LL...QPVLV.R.DP.SRKNT.NEI.RR.TS...WPQ.L.FPEG.CTNR.CL.TFK.GAF.PGVPVQP.LLRYPN.LDTV
Retrocopy
AGLPSVVSASQNALIPVAGKLLLSTQPVLVTREDPNSRKNTKNEILRRVTSERKWPQILIFPEGVCTNRTCLVTFKLGAFSPGVPVQPVLLRYPNTLDTV


Parental protein
TWTWQGYTFIQLCMLTFCQPFTRVEVEFMPVQVPNEEERNDPVLFADRVRNLMAQALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRKLKLDW
TWTWQG.T..Q.CMLT..Q.FTRVEVEFMPV..PN.....DPVLFA..VR..MA.ALG.PVTDHTYEDCRLMIS.G.L.LP.EAGLV.FTKIS.KLKLDW
Retrocopy
TWTWQGFTGFQACMLTLSQLFTRVEVEFMPVYIPNDQXXXDPVLFANTVRINMANALGVPVTDHTYEDCRLMISTGNLQLPTEAGLVGFTKISQKLKLDW


Parental protein
DGIRKHLDEYATIASSSKGGRIGIEEFAEYLKLP-VSDVLRQLFALFDRNHDGSIDFREYVIGLAVLCNPANTEEIIQVAFKLFDVDEDGHITEEEFSTI
D.I..HLDEYA.IA..SKGG.I.I.E.....K.P.....LRQLFALFDRN..GSID.REYVIGL.VLCN.ANTE.I.Q..FK.FD.DE.G.IT..E....
Retrocopy
DNIHQHLDEYAAIAVASKGGKIEI-EVCKLFKTP\I*EPLRQLFALFDRNNEGSIDLREYVIGLTVLCNSANTEKILQMSFKFFDLDEHGFITKQELAAT


Parental protein
LQASLGVPDLDVSGLFKEIA--QGDSVSYEEFKSFALKHPEYAKIFTTYLDLQTSHVF
L....GVPDLDVS.LF.EIA.....S.SYE.FK.FAL.HP.YAK.F..YLDLQ.....
Retrocopy
LWTAFGVPDLDVSRLFQEIAGQSSESISYEKFKKFALRHPQYAKLFNSYLDLQAAYIY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide