RetrogeneDB ID:
retro_ecab_866
Organism:
Horse ( Equus_caballus )
Location:
5:75335651-75336573 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
87.78 %
Coverage:
100.0 %
Frameshifts:
4
Stop codons:
1


Parental gene:
Parental gene symbol:
GTF3A
Parental gene aliases:
No gene alias available
Parental gene description:
general transcription factor IIIA [Source:HGNC Symbol;Acc:4662]

Genomic region (view in browser)





>retro_ecab_866
AGACCATTTGTCTGTGACCGTGAAGGGTGTGGCAAAGCCCTTTGTCAGGGACTACCGTCT
GAGCGGCCACATCCTGATTCACACTGGAGAAAAGCCATTTGGTTTGTGCAGCTAGTGGCT
GTGATCAAAAATTTCAACACAAAGTCAAACTTGGAGGAAACCATTTTGGAACGCAAACAT
GAAAATCCGCAGAAACAGTATGTATGCAGTTTTTGAAAGGTTGGTGAGAAGACCTTTAGG
AAACAAGCAGCAGCTGAACATCCATCAGTGCCAGCACACCAACGGACCACTGTTTAAGTG
TACCCATGAAGGATGTGGAAAGCACTTCGCTTCTCCCCGTGGGCTGAAACGGCAGGGGAA
GGTCCACGAGGGTTATATATGTCAAAAAGAATGTTCCTTCGTGGCAAAAACATGGACAGA
GCTTCTGAAACATGTGAGAGAAGCCCATCAAGGGGAGATAAGATGTGAAGTATGCCAGAA
AACATTTAAACGCAAAGATTATCTGAAGCAACATAAGAAAACTGATGCCCCGGAGTGGGA
TGTGTGTCGATGTCCAAGAGAAGGCTGTGATAGAACCTACACAACCGTGTCTAATCTCCA
GAGCCATATTCTCTCTTTTCATGAGGAAAGGTGCCCGTTTACACGTGAACATGCTGGCTG
TGGCAAGACGTTTGCAATGAAGCAAAGTCTCACTAGGCATGCCGTCGCACATGACCCTGA
CAAGAAAATGAAGCTCAAAGTAAAACCTACTCGAGAAAAGCGGAGTTTGGCCTCTCGTGT
CAGTGGATATATCCCTCCTAAAAAGAAACAAGAACAAGGCGTATCTCTGCCAACAAACGG
AGAGTCACTGCGCTGCCCTCCAGACCGGGCGCCCCTGACCATTGCAGTGCTCGCCCTCAG
CCAGAGAGCATCTTGCTTTGTT

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.46
SRP021940_cerebellum 1.15
SRP021940_embryo 1.01
SRP021940_placental_villous 0.63
SRP021940_synovial_membrane 0.76
SRP021940_testis 15.07

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RPFVCDHEGCGKA-FVRDYHLSRHILIHTGEKPF-VCAASGCDQKF-NTKSNLRKHF-ERKHENQQKQYVCSF-EGCEKTFRKH-QQLKIHQCQHTNEPL
RPFVCD.EGCGKA.FVRDY.LS.HILIHTGEKPF.VCAASGCDQKF.NTKSNL.....ERKHEN.QKQYVCSF....EKTFRK..QQL.IHQCQHTN.PL
Retrocopy
RPFVCDREGCGKA\FVRDYRLSGHILIHTGEKPF\VCAASGCDQKF\NTKSNLEETILERKHENPQKQYVCSF*KVGEKTFRKQ\QQLNIHQCQHTNGPL


Parental protein
FKCTHEGCGKHFASPSGLKRHGKVHEGYICQKECSFVAKTWTDLLKHVREAHQEEIRCEVCQKTFKRKDYLKQHMKTHAPERDVCRCPREGCDRTYTTVF
FKCTHEGCGKHFASP.GLKR.GKVHEGYICQKECSFVAKTWT.LLKHVREAHQ.EIRCEVCQKTFKRKDYLKQH.KT.APE.DVCRCPREGCDRTYTTV.
Retrocopy
FKCTHEGCGKHFASPRGLKRQGKVHEGYICQKECSFVAKTWTELLKHVREAHQGEIRCEVCQKTFKRKDYLKQHKKTDAPEWDVCRCPREGCDRTYTTVS


Parental protein
NLQSHILSFHEERRPFTCEHAGCGKTFAMKQSLTRHAVVHDPDKKKMKLKVKPSREKRSLASRLSGYIPPKKKQEQGVSLPTNGESLRCPPDQVPLTAAV
NLQSHILSFHEER.PFT.EHAGCGKTFAMKQSLTRHAV.HDPD.KKMKLKVKP.REKRSLASR.SGYIPPKKKQEQGVSLPTNGESLRCPPD..PLT.AV
Retrocopy
NLQSHILSFHEERCPFTREHAGCGKTFAMKQSLTRHAVAHDPD-KKMKLKVKPTREKRSLASRVSGYIPPKKKQEQGVSLPTNGESLRCPPDRAPLTIAV


Parental protein
LALSQRAACFV
LALSQRA.CFV
Retrocopy
LALSQRASCFV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide