RetrogeneDB ID:
retro_ecab_872
Organism:
Horse ( Equus_caballus )
Location:
6:18101265-18101503 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.44 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
BIK
Parental gene aliases:
No gene alias available
Parental gene description:
BCL2-interacting killer (apoptosis-inducing) [Source:HGNC Symbol;Acc:1051]

Genomic region (view in browser)





>retro_ecab_872
ATGTCTCAAGCAGGCTCCCTCTCCAGGGACCTCTTTTTGGACACCTTCCTGTGTGAGCAT
GTTCTGGAACCTGAGGAGGTTCCTGGCACGATCGATCTCACGGACTACGTTGACCGTGAG
TCCTCCCCCGACAGTGACAACCCCGACGACGTTGCCCTGCAGCTGGCCTTCATCATGACG
AGAAAGAATTGTCATGGATGCTGCTCACCTTGCTCAGCTGCCCCAGATGGCCATGTAC

Library Expression (reads per million mapped reads)
SRP021940_articular_cartilage 0.0
SRP021940_cerebellum 0.05
SRP021940_embryo 0.0
SRP021940_placental_villous 0.0
SRP021940_synovial_membrane 0.03
SRP021940_testis 0.0

Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MSQVGPVSRDLFLDAFLHERSPEALEVPGMTELTDSQSPSPQGEGDNRDSVAMRLAFI-GDEMEVRWML-PHIAELPGVAVY
MSQ.G..SRDLFLD.FL.E...E..EVPG...LTD..........DN.D.VA..LAFI..DE.E..WML..H.A.LP..A.Y
Retrocopy
MSQAGSLSRDLFLDTFLCEHVLEPEEVPGTIDLTDYVDRESSPDSDNPDDVALQLAFI/HDEKELSWML/AHLAQLPQMAMY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide